KEGG   Addendum: AAG13912
Entry
AAG13912          CDS       T10000                                 

Gene name
megDIII
Definition
(KEGG) N,N-dimethyltransferase
  KO
K13326  dTDP-3-amino-2,3,6-trideoxy-4-keto-D-glucose/dTDP-3-amino-3,4,6-trideoxy-alpha-D-glucopyranose N,N-dimethyltransferase [EC:2.1.1.- 2.1.1.234]
Taxonomy
TAX:47868
  Lineage
Bacteria; Actinobacteria; Micromonosporales; Micromonosporaceae; Micromonospora
Organism
ag  Addendum (Micromonospora megalomicea)
SSDB
Motif
Pfam: Methyltransf_25 Methyltransf_11 Methyltransf_31 Methyltransf_23 Methyltransf_12 NodS Ubie_methyltran Methyltransf_15 TPMT MTS NNMT_PNMT_TEMT MetW CMAS DUF938 tRNA_U5-meth_tr Methyltransf_4
Other DBs
NCBI-ProteinID: AAG13912
GB: AF263245
UniProt: Q9F836
AA seq 257 aa
MPNSHSTTSSTDVAPYERADIYHDFYHGRGKGYRAEADALVEVARKHTPQAATLLDVACG
TGSHLVELADSFREVVGVDLSAAMLATAARNDPGRELHQGDMRDFSLDRRFDVVTCMFSS
TGYLVDEAELDRAVANLAGHLAPGGTLVVEPWWFPETFRPGWVGADLVTSGDRRISRMSH
TVPAGLPDRTASRMTIHYTVGSPEAGIEHFTEVHVMTLFARAAYEQAFQRAGLSCSYVGH
DLFSPGLFVGVAAEPGR
Reference
  Authors
Volchegursky Y, Hu Z, Katz L, McDaniel R
  Title
Biosynthesis of the anti-parasitic agent megalomicin: transformation of erythromycin to megalomicin in Saccharopolyspora erythraea.
  Journal
Mol Microbiol 37:752-62 (2000)
DOI:10.1046/j.1365-2958.2000.02059.x

DBGET integrated database retrieval system