KEGG   Addendum: AAG23280
Entry
AAG23280          CDS       T10000                                 

Gene name
spnS
Definition
(KEGG) N-dimethyltransferase
  KO
K13330  dTDP-4-amino-2,3,4,6-tetradeoxy-D-glucose N,N-dimethyltransferase [EC:2.1.1.324]
Taxonomy
TAX:60894
  Lineage
Bacteria; Actinobacteria; Pseudonocardiales; Pseudonocardiaceae; Saccharopolyspora
Organism
ag  Addendum (Saccharopolyspora spinosa)
Module
60894_M00802  dTDP-D-forosamine biosynthesis
SSDB
Motif
Pfam: Methyltransf_25 Methyltransf_11 Methyltransf_23 Methyltransf_12 Methyltransf_31 NodS Ubie_methyltran CMAS Methyltransf_8 DREV NNMT_PNMT_TEMT
Other DBs
NCBI-ProteinID: AAG23280
GB: AY007564
UniProt: Q9ALP0
AA seq 249 aa
MSRVSDTFAETSSVYSPDHADIYDAIHSARGRDWAAEAGEVVQLVRTRLPEAQSLLDVAC
GTGAHLERFRAEYAKVAGLELSDAMREIAIRRVPEVPIHIGDIRDFDLGEPFDVITCLCF
TAAYMRTVDDLRRVTRNMARHLAPGGVAVIEPWWFPDKFIDGFVTGAVAHHGERVISRLS
HSVLEGRTSRMTVRYTVAEPTGIRDFTEFEILSLFTEDEYTAALEDAGIRAEYLPGAPNG
RGLFVGIRN
Reference
  Authors
Waldron C, Matsushima P, Rosteck PR Jr, Broughton MC, Turner J, Madduri K, Crawford KP, Merlo DJ, Baltz RH
  Title
Cloning and analysis of the spinosad biosynthetic gene cluster of Saccharopolyspora spinosa.
  Journal
Chem Biol 8:487-99 (2001)
DOI:10.1016/S1074-5521(01)00029-1

DBGET integrated database retrieval system