KEGG   Addendum: AAL06397
Entry
AAL06397          CDS       T10000                                 

Definition
(KEGG) (+)-menthofuran synthase (EC:1.14.14.143)
  KO
K15093  (+)-menthofuran synthase [EC:1.14.14.143]
Taxonomy
TAX:34256
  Lineage
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Menthinae; Mentha
Organism
ag  Addendum (Mentha x piperita)
Motif
Pfam: p450
Other DBs
NCBI-ProteinID: AAL06397
GB: AF346833
UniProt: Q947B7
AA seq 493 aa
MAALLVFFSVSLILLAVLFHKRKSSLSSRKRPPPSPLRLPVIGHFHLIGALSHRSFTSLS
KRYGEVMLLHFGSAPVLVASSAAAAREIMKNQDVIFASRPRLSIFDRLMYSGKGVAFAPY
GEHWRNARSMCMLQLLSAKRVQSFGGIREEETSAMIEKIRRSKPTTVVNLSEMFMALTNG
VIHRAVLGRKGDGGDDFNRILIKVIKLLGSFNVGDYVPWLSWINRINGVDAEVEKVGTKL
DGSMEGILRKYRRKKVGDDETNFVDTLLQFQRESKDTDPVEDDVIKALIFDMVSAGTDTT
FAALEWTMAELIKNPRTLKTLQNEVREVSRNKGGITEDDVDKMPYLKAVSKEILRLHPPF
AILLPRELTQDANMLGYDIPRGTVVLVNNWAISRDPSLWENPEEFRPERFLETSIDYKGL
HFEMLPFGSGRRGCPGSTFAMALYELALSKLVNEFDFRLGNGDRAEDLDMTEAPGFVVHK
KSPLLVLATPRQS
Reference
  Authors
Bertea CM, Schalk M, Karp F, Maffei M, Croteau R
  Title
Demonstration that menthofuran synthase of mint (Mentha) is a cytochrome P450 monooxygenase: cloning, functional expression, and characterization of the responsible gene.
  Journal
Arch Biochem Biophys 390:279-86 (2001)
DOI:10.1006/abbi.2001.2378

DBGET integrated database retrieval system