KEGG   Addendum: AAL09965
Entry
AAL09965          CDS       T10000                                 
Symbol
LPS
Name
(KEGG) levopimaradiene synthase / copalyl diphosphate synthase (EC:4.2.3.32)
  KO
K14041  levopimaradiene/copalyl diphosphate synthase [EC:4.2.3.32 5.5.1.12]
Taxonomy
TAX:3311
  Lineage
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Ginkgoidae; Ginkgoales; Ginkgoaceae; Ginkgo
Organism
ag  Addendum (Ginkgo biloba)
SSDB
Motif
Pfam: Terpene_synth_C Terpene_synth Terpene_syn_C_2 Prenyltrans SQHop_cyclase_C
Other DBs
NCBI-ProteinID: AAL09965
GB: AF331704
UniProt: Q947C4
AA seq 873 aa
MAGVLFANLPCSLQLSPKVPFRQSTNILIPFHKRSSFGFNAQHCVRSHLRLRWNCVGIHA
SAAETRPDQLPQEERFVSRLNADYHPAVWKDDFIDSLTSPNSHATSKSSVDETINKRIQT
LVKEIQCMFQSMGDGETNPSAYDTAWVARIPSIDGSGAPQFPQTLQWILNNQLPDGSWGE
ECIFLAYDRVLNTLACLLTLKIWNKGDIQVQKGVEFVRKHMEEMKDEADNHRPSGFEVVF
PAMLDEAKSLGLDLPYHLPFISQIHQKRQKKLQKIPLNVLHNHQTALLYSLEGLQDVVDW
QEITNLQSRDGSFLSSPASTACVFMHTQNKRCLHFLNFVLSKFGDYVPCHYPLDLFERLW
AVDTVERLGIDRYFKKEIKESLDYVYRYWDAERGVGWARCNPIPDVDDTAMGLRILRLHG
YNVSSDVLENFRDEKGDFFCFAGQTQIGVTDNLNLYRCSQVCFPGEKIMEEAKTFTTNHL
QNALAKNNAFDKWAVKKDLPGEVEYAIKYPWHRSMPRLEARSYIEQFGSNDVWLGKTVYK
MLYVSNEKYLELAKLDFNMVQALHQKETQHIVSWWRESGFNDLTFTRQRPVEMYFSVAVS
MFEPEFAACRIAYAKTSCLAVILDDLYDTHGSLDDLKLFSEAVRRWDISVLDSVRDNQLK
VCFLGLYNTVNGFGKDGLKEQGRDVLGYLRKVWEGLLASYTKEAEWSAAKYVPTFNEYVE
NAKVSIALATVVLNSIFFTGELLPDYILQQVDLRSKFLHLVSLTGRLINDTKTYQAERNR
GELVSSVQCYMRENPECTEEEALSHVYGIIDNALKELNWELANPASNAPLCVRRLLFNTA
RVMQLFYMYRDGFGISDKEMKDHVSRTLFDPVA
Reference
  Authors
Schepmann HG, Pang J, Matsuda SP
  Title
Cloning and characterization of Ginkgo biloba levopimaradiene synthase which catalyzes the first committed step in ginkgolide biosynthesis.
  Journal
Arch Biochem Biophys 392:263-9 (2001)
DOI:10.1006/abbi.2001.2438
Reference
  Authors
Ro DK, Bohlmann J
  Title
Diterpene resin acid biosynthesis in loblolly pine (Pinus taeda): functional characterization of abietadiene/levopimaradiene synthase (PtTPS-LAS) cDNA and subcellular targeting of PtTPS-LAS and abietadienol/abietadienal oxidase (PtAO, CYP720B1).
  Journal
Phytochemistry 67:1572-8 (2006)
DOI:10.1016/j.phytochem.2006.01.011

DBGET integrated database retrieval system