KEGG   Addendum: AAM77991
Entry
AAM77991          CDS       T10000                                 
Symbol
ncsC5
Name
(KEGG) N-methyltransferase
  KO
K21215  N-methyltransferase [EC:2.1.1.-]
Taxonomy
TAX:1897
  Lineage
Bacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces
Organism
Streptomyces carzinostaticus
SSDB
Motif
Pfam: Methyltransf_11 Methyltransf_25 Methyltransf_12 CheR Methyltransf_23 DREV RrnaAD
Other DBs
NCBI-ProteinID: AAM77991
GB: AY117439
UniProt: Q84HC1
AA seq 239 aa
MSAWLEEWNSRQDVYIGDRHRDRHFRAVAGDIVRLLPQGARRVLDYGPGDALSATRIAAA
CEEVVLCEAAETIRARISDRFANDPAIRVISPGQLADLAAGSVDLVVVHSVVQYLDADEL
DALLREVHRLLGADGLLVVGDLVPPGTGLVSDTAELLRFALREGFLGEAVPALVRLAFSP
YARRRRRLGLTRIDEAEMTARARRAGLSGHRVRPNIGNNQRRWTFVARRAAASSVRPSR
Reference
  Authors
Liu W, Nonaka K, Nie L, Zhang J, Christenson SD, Bae J, Van Lanen SG, Zazopoulos E, Farnet CM, Yang CF, Shen B
  Title
The neocarzinostatin biosynthetic gene cluster from Streptomyces carzinostaticus ATCC 15944 involving two iterative type I polyketide synthases.
  Journal
Chem Biol 12:293-302 (2005)
DOI:10.1016/j.chembiol.2004.12.013

DBGET integrated database retrieval system