KEGG   Addendum: AAN87574
Entry
AAN87574          CDS       T10000                                 
Symbol
FADX
Name
(KEGG) delta12 acyl-lipid conjugase (11E,13E-forming) / acyl-lipid (9+3)-(E)-desaturase (EC:1.14.19.33 1.14.19.34)
  KO
K21736  Delta12 acyl-lipid conjugase (11E,13E-forming) / acyl-lipid (9+3)-(E)-desaturase [EC:1.14.19.33 1.14.19.34]
Taxonomy
TAX:73154
  Lineage
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Aleuritideae; Vernicia
Organism
ag  Addendum (Vernicia fordii)
SSDB
Motif
Pfam: FA_desaturase DUF3474
Other DBs
NCBI-ProteinID: AAN87574
GB: AF525535
UniProt: Q8GZC2
AA seq 386 aa
MGAGGRMSVAPNNSKCEKKESRSVKRVPHTKPPFTLGQLKQAIPSHCFKRSLLRSFSYVV
YDLSLSFIFYSIATTYFHLLPSPITYIAWPVYWAFQGCILTSVWVLGHECGHHAFSEYNW
LDDTIGLILHSSLLVPYFSFKISHRRHHSNIASLERDEVFVPRLKSAIPWYSKYLNNPPG
RALTLVATLFIGWPLYLAFNVSGRYYDRFACHYDPYSPIYSDRERLQIYISDAMIFVAAY
VLYKIAMAKGLAWLVCIYGVPLLIVNALVVTITSLQHTHVALPHYDSSEWDWLRGGLATV
DRDYGVFNKIFHNATDTHVIHHLFSSMPHYHGVEATRAIKPILGDYYLFDDTPIHVALWR
EAKECLFVEPDEGDNNNGVFWYSNKF
Reference
  Authors
Dyer JM, Chapital DC, Kuan JC, Mullen RT, Turner C, McKeon TA, Pepperman AB
  Title
Molecular analysis of a bifunctional fatty acid conjugase/desaturase from tung. Implications for the evolution of plant fatty acid diversity.
  Journal
Plant Physiol 130:2027-38 (2002)
DOI:10.1104/pp.102.010835

DBGET integrated database retrieval system