KEGG   Addendum: AAP05761
Entry
AAP05761          CDS       T10000                                 

Symbol
EAS
Name
(KEGG) 5-epiaristolochene synthase (EC:4.2.3.61)
  KO
K15804  5-epiaristolochene synthase [EC:4.2.3.61]
Taxonomy
TAX:49451
  Lineage
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Organism
ag  Addendum (Nicotiana attenuata)
SSDB
Motif
Pfam: Terpene_synth_C Terpene_synth Terpene_syn_C_2 Flu_C_NS1
Other DBs
NCBI-ProteinID: AAP05761
GB: AF484124
UniProt: Q84LF1
AA seq 548 aa
MASAAVGNYEEEIVRPVADFSPSLWGDHFLSFSIDNQVAEKYAQEIEPLKEQTRSMLLAT
GRKLADTLNLIDTIERLGISYYFEKEIDEILDHIYNQNSNCNDFCTSALQFRLLRQHGFN
ISPQIFSKFQDENGKFRESLASDVLGLLNLYEASHVRTHADDILEDALAFSTIHLESAAP
HLKSPLREQVTHALEQCLHKGVPRVETRFFISSIYEKEQSKNNVLLRFAKLDFNLLQMLH
KQELAEVSRWWKDLDFVTTLPYARDRVVECYFWALGVYFEPQYSQARVMLVKTISMISIV
DDTFDAYGTVKELEAYTDAIQRWDINEIDRLPHYMKISYKAILDLYKDYEKELSSAEKSH
IVCHAIERMKEVVGHYNVESTWFIEGYMPPVSEYLSNALATTTYYYLATTSYLGMKSATE
QDFEWLSKNPKILEASVIICRVIDDTATYEVEKSRGQIATGIECCMRDYGISTKKAMAKF
QKMAETAWKDINEGLLRPTPVSTEFLTLILNLARIVEVTYIHNLDGYTHPEKVLKPHIIN
LLVDSIKI
Reference
  Authors
Bohlmann J, Stauber EJ, Krock B, Oldham NJ, Gershenzon J, Baldwin IT
  Title
Gene expression of 5-epi-aristolochene synthase and formation of capsidiol in roots of Nicotiana attenuata and N. sylvestris.
  Journal
Phytochemistry 60:109-16 (2002)
DOI:10.1016/S0031-9422(02)00080-8

DBGET integrated database retrieval system