KEGG   Addendum: AAQ08379
Entry
AAQ08379          CDS       T10000                                 

Name
(KEGG) acetylene hydratase (EC:4.2.1.112)
  KO
K20625  acetylene hydratase [EC:4.2.1.112]
Taxonomy
TAX:29542
  Lineage
Bacteria; Proteobacteria; Deltaproteobacteria; Desulfuromonadales; Syntrophotaleaceae; Syntrophotalea
Organism
ag  Addendum (Syntrophotalea acetylenica)
SSDB
Motif
Pfam: Molybdopterin Molydop_binding MoeA_C
Other DBs
NCBI-ProteinID: AAQ08379
GB: AF518725
UniProt: Q71EW5
Structure
PDB: 
2E7Z

AA seq 730 aa
MASKKHVVCQSCDINCVVEAEVKADGKIQTKSISEPHPTTPPNSICMKSVNADTIRTHKD
RVLYPLKNVGSKRGEQRWERISWDQALDEIAEKLKKIIAKYGPESLGVSQTEINQQSEYG
TLRRFMNLLGSPNWTSAMYMCIGNTAGVHRVTHGSYSFASFADSNCLLFIGKNLSNHNWV
SQFNDLKAALKRGCKLIVLDPRRTKVAEMADIWLPLRYGTDAALFLGMINVIINEQLYDK
EFVENWCVGFEELKERVQEYPLDKVAEITGCDAGEIRKAAVMFATESPASIPWAVSTDMQ
KNSCSAIRAQCILRAIVGSFVNGAEILGAPHSDLVPISKIQMHEALPEEKKKLQLGTETY
PFLTYTGMSALEEPSERVYGVKYFHNMGAFMANPTALFTAMATEKPYPVKAFFALASNAL
MGYANQQNALKGLMNQDLVVCYDQFMTPTAQLADYVLPGDHWLERPVVQPNWEGIPFGNT
SQQVVEPAGEAKDEYYFIRELAVRMGLEEHFPWKDRLELINYRISPTGMEWEEYQKQYTY
MSKLPDYFGPEGVGVATPSGKVELYSSVFEKLGYDPLPYYHEPLQTEISDPELAKEYPLI
LFAGLREDSNFQSCYHQPGILRDAEPDPVALLHPKTAQSLGLPSGEWIWVETTHGRLKLL
LKHDGAQPEGTIRIPHGRWCPEQEGGPETGFSGAMLHNDAMVLSDDDWNLDPEQGLPNLR
GGILAKAYKC
Comment
Unpublished sequence data: Abt DJ, Brinkmann H, Meyer A, Schink B, Kroneck PMH (2002).
Reference
  Authors
Seiffert GB, Ullmann GM, Messerschmidt A, Schink B, Kroneck PM, Einsle O
  Title
Structure of the non-redox-active tungsten/[4Fe:4S] enzyme acetylene hydratase.
  Journal
Proc Natl Acad Sci U S A 104:3073-7 (2007)
DOI:10.1073/pnas.0610407104

DBGET integrated database retrieval system