KEGG   Addendum: AAQ16575
Entry
AAQ16575          CDS       T10000                                 
Symbol
BOT2
Name
(KEGG) presilphiperfolanol synthase (EC:4.2.3.74)
  KO
K22056  presilphiperfolanol synthase [EC:4.2.3.74]
Taxonomy
TAX:40559
  Lineage
Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina; Leotiomycetes; Helotiales; Sclerotiniaceae; Botrytis
Organism
Botrytis cinerea
SSDB
Motif
Pfam: Terpene_syn_C_2 Terpene_synth_C DUF4525
Other DBs
NCBI-ProteinID: AAQ16575
GB: AY277723
UniProt: Q6WP50
AA seq 399 aa
MAIPALEPQLHDADTSSNNMSSNSTDSGYDTNSTTPLEKSEKPNTQELKQQQLDPKRPPF
VRVPDLFGSIMSTKPVVNPNYFAAKARGDRWIARVMNFNKAVAARNSKVDLCFLASMWAP
DAPEDRLVMMLDWNHWVFLFDDQFDEGHLKEDPAAAAEEVKQTIAIMGGNAPRYTAESNP
IRYVFQQCWDRLKAVSSQEMQQRWIDQHKRYFDQLLVQVDQQVGGENFTRDVEAYMDLRR
GTIGVYPAISLSEYGAGVNVPQHVYDHPSLQECMKVSADLVTLVNDVLSYRKDLELGVDH
NLMSLLMQRDNLSAQQAVDVIGDMVNECYRRWYLALAELPSYGEKIDYNVMKFVEICRAV
AQGNLYWSFQTGRYLGPEGHEVHETGIMYLPPAANLVVA
Reference
  Authors
Viaud M, Brunet-Simon A, Brygoo Y, Pradier JM, Levis C
  Title
Cyclophilin A and calcineurin functions investigated by gene inactivation, cyclosporin A inhibition and cDNA arrays approaches in the phytopathogenic fungus Botrytis cinerea.
  Journal
Mol Microbiol 50:1451-65 (2003)
DOI:10.1046/j.1365-2958.2003.03798.x
Reference
  Authors
Pinedo C, Wang CM, Pradier JM, Dalmais B, Choquer M, Le Pecheur P, Morgant G, Collado IG, Cane DE, Viaud M
  Title
Sesquiterpene synthase from the botrydial biosynthetic gene cluster of the phytopathogen Botrytis cinerea.
  Journal
ACS Chem Biol 3:791-801 (2008)
DOI:10.1021/cb800225v

DBGET integrated database retrieval system