KEGG   Addendum: AAQ56240
Entry
AAQ56240          CDS       T10000                                 
Name
(KEGG) taxadiene 5alpha-hydroxylase
  KO
K14039  taxadiene 5alpha-hydroxylase [EC:1.14.14.176]
Taxonomy
TAX:99806
  Lineage
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Pinopsida; Pinidae; Conifers II; Cupressales; Taxaceae; Taxus
Organism
Taxus cuspidata
SSDB
Motif
Pfam: p450
Other DBs
NCBI-ProteinID: AAQ56240
GB: AY289209
UniProt: Q6WG30
AA seq 499 aa
MDALYKSTVAKFNEVTQLDCSTESFSIALSAIAGILLLLLLFRSKRHSSLKLPPGKLGIP
FIGESFIFLRALRSNSLEQFFDERVKKFGLVFKTSLIGHPTVVLCGPAGNRLILSNEEKL
VQMSWPAQFMKLMGENSVATRRGEDHIVMRSALAGFFGPGALQSYIGKMNTEIQSHINEK
WKGKDEVNVLPLVRELVFNISAILFFNIYDKQEQDRLHKLLETILVGSFALPIDLPGFGF
HRALQGRAKLNKIMLSLIKKRKEDLQSGSATATQDLLSVLLTFRDDKGTPLTNDEILDNF
SSLLHASYDTTTSPMALIFKLLSSNPECYQKVVQEQLEILSNKEEGEEITWKDLKAMKYT
WQVAQETLRMFPPVFGTFRKAITDIQYDGYTIPKGWKLLWTTYSTHPKDLYFNEPEKFMP
SRFDQEGKHVAPYTFLPFGGGQRSCVGWEFSKMEILLFVHHFVKTFSSYTPVDPDEKISG
DPLPPLPSKGFSIKLFPRP
Reference
  Authors
Jennewein S, Long RM, Williams RM, Croteau R
  Title
Cytochrome p450 taxadiene 5alpha-hydroxylase, a mechanistically unusual monooxygenase catalyzing the first oxygenation step of taxol biosynthesis.
  Journal
Chem Biol 11:379-87 (2004)
DOI:10.1016/j.chembiol.2004.02.022

DBGET integrated database retrieval system