KEGG   Addendum: AAR11765
Entry
AAR11765          CDS       T10000                                 

Symbol
GES
Name
(KEGG) geranyl diphosphate diphosphatase (EC:3.1.7.11)
  KO
K20979  geranyl diphosphate diphosphatase [EC:3.1.7.11]
Taxonomy
TAX:39350
  Lineage
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ociminae; Ocimum
Organism
ag  Addendum (Ocimum basilicum)
SSDB
Motif
Pfam: Terpene_synth_C Terpene_syn_C_2 Terpene_synth
Other DBs
NCBI-ProteinID: AAR11765
GB: AY362553
UniProt: Q6USK1
AA seq 567 aa
MSCARITVTLPYRSAKTSIQRGITHYPALIRPRFSACTPLASAMPLSSTPLINGDNSQRK
NTRQHMEESSSKRREYLLEETTRKLQRNDTESVEKLKLIDNIQQLGIGYYFEDAINAVLR
SPFSTGEEDLFTAALRFRLLRHNGIEISPEIFLKFKDERGKFDESDTLGLLSLYEASNLG
VAGEEILEEAMEFAEARLRRSLSEPAAPLHGEVAQALDVPRHLRMARLEARRFIEQYGKQ
SDHDGDLLELAILDYNQVQAQHQSELTEIIRWWKELGLVDKLSFGRDRPLECFLWTVGLL
PEPKYSSVRIELAKAISILLVIDDIFDTYGEMDDLILFTDAIRRWDLEAMEGLPEYMKIC
YMALYNTTNEVCYKVLRDTGRIVLLNLKSTWIDMIEGFMEEAKWFNGGSAPKLEEYIENG
VSTAGAYMAFAHIFFLIGEGVTHQNSQLFTQKPYPKVFSAAGRILRLWDDLGTAKEEQER
GDLASCVQLFMKEKSLTEEEARSRILEEIKGLWRDLNGELVYNKNLPLSIIKVALNMARA
SQVVYKHDQDTYFSSVDNYVDALFFTQ
Reference
  Authors
Iijima Y, Gang DR, Fridman E, Lewinsohn E, Pichersky E
  Title
Characterization of geraniol synthase from the peltate glands of sweet basil.
  Journal
Plant Physiol 134:370-9 (2004)
DOI:10.1104/pp.103.032946

DBGET integrated database retrieval system