KEGG   Addendum: AAR26385
Entry
AAR26385          CDS       T10000                                 
Symbol
5MaT2
Name
(KEGG) anthocyanin 5-O-glucoside-4'''-O-malonyltransferase (EC:2.3.1.214)
  KO
K12935  anthocyanin 5-O-glucoside-4'''-O-malonyltransferase [EC:2.3.1.214]
Taxonomy
TAX:180675
  Lineage
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salviinae; Salvia; Salvia subgen. Calosphace; core Calosphace
Organism
ag  Addendum (Salvia splendens)
SSDB
Motif
Pfam: Transferase Calsequestrin
Other DBs
NCBI-ProteinID: AAR26385
GB: AY383734
UniProt: Q6TXD2
AA seq 417 aa
MNINQINTKLIKPITPTPQNLKNYHISFLDQHVVKKYIAVVLYYQSAPDNGRLEDSLAET
LVHFYPLAGRYIKTDLTVDCSDQGAEFIEAEARGDVRVTDLIGKTDTIHLCPEQYFGLDE
GVDDPLLSIQVTRFSCGGATIAVSVSHRVFDVSSLETFLSAWSSASKTGGGVAPVIPSFA
LASLLPNKDEKFGLDSNKCQGKEQKIAVKRLLFEKRALTRLTSERTSGVRAACAVIAKAL
IRLDRTTHGKSRDFVVFQPINMRGRTGVPSPKNACGNMSFGSFTRRVSAKEEVGIGELVG
LIGDGVRRGIAEYTEILCPDRDGRDVIIHVRNKNIKEVFKSETFVVSFTDWSKFGFYEVD
FGWGRPIWSGVGPQRPRGNQTIMMRSKEGDGIEAWVHLNEDDMDLFEQDVEIKLFLS
Reference
  Authors
Suzuki H, Sawada S, Watanabe K, Nagae S, Yamaguchi MA, Nakayama T, Nishino T.
  Title
Identification and characterization of a novel anthocyanin malonyltransferase from scarlet sage (Salvia splendens) flowers: an enzyme that is phylogenetically separated from other anthocyanin acyltransferases.
  Journal
Plant J 38:994-1003 (2004)
DOI:10.1111/j.1365-313X.2004.02101.x

DBGET integrated database retrieval system