KEGG   Addendum: AAS55720
Entry
AAS55720          CDS       T10000                                 
Symbol
fdtA
Name
(KEGG) TDP-4-oxo-6-deoxy-alpha-D-glucose-3,4-oxoisomerase (dTDP-3-dehydro-6-deoxy-alpha-D-galactopyranose-forming) (EC:5.3.2.3)
  KO
K20679  TDP-4-oxo-6-deoxy-alpha-D-glucose-3,4-oxoisomerase [EC:5.3.2.3]
Taxonomy
TAX:143495
  Lineage
Bacteria; Firmicutes; Bacilli; Bacillales; Paenibacillaceae; Aneurinibacillus group; Aneurinibacillus
Organism
Aneurinibacillus thermoaerophilus
SSDB
Motif
Pfam: FdtA
Other DBs
NCBI-ProteinID: AAS55720
GB: AY442352
UniProt: Q6T1W8
Structure
AA seq 139 aa
MENKVINFKKIIDSRGSLVAIEENKNIPFSIKRVYYIFDTKGEEPRGFHAHKKLEQVLVC
LNGSCRVILDDGNIIQEITLDSPAVGLYVGPAVWHEMHDFSSDCVMMVLASDYYDETDYI
RQYDNFKKYIAKINLEKEG
Reference
  Authors
Novotny R, Pfoestl A, Messner P, Schaffer C
  Title
Genetic organization of chromosomal S-layer glycan biosynthesis loci of Bacillaceae.
  Journal
Glycoconj J 20:435-47 (2004)
DOI:10.1023/B:GLYC.0000038290.74944.65
Reference
  Authors
Pfoestl A, Hofinger A, Kosma P, Messner P
  Title
Biosynthesis of dTDP-3-acetamido-3,6-dideoxy-alpha-D-galactose in Aneurinibacillus thermoaerophilus L420-91T.
  Journal
J Biol Chem 278:26410-7 (2003)
DOI:10.1074/jbc.M300858200
Reference
  Authors
Davis ML, Thoden JB, Holden HM
  Title
The x-ray structure of dTDP-4-keto-6-deoxy-D-glucose-3,4-ketoisomerase.
  Journal
J Biol Chem 282:19227-36 (2007)
DOI:10.1074/jbc.M702529200

DBGET integrated database retrieval system