KEGG   Addendum: AAS55722
Entry
AAS55722          CDS       T10000                                 
Symbol
fdtB
Name
(KEGG) dTDP-3-amino-3,6-dideoxy-alpha-D-galactopyranose transaminase (EC:2.6.1.90)
  KO
K20680  dTDP-3-amino-3,6-dideoxy-alpha-D-galactopyranose transaminase [EC:2.6.1.90]
Taxonomy
TAX:143495
  Lineage
Bacteria; Bacillota; Bacilli; Bacillales; Paenibacillaceae; Aneurinibacillus group; Aneurinibacillus
Organism
Aneurinibacillus thermoaerophilus
SSDB
Motif
Pfam: DegT_DnrJ_EryC1 Aminotran_1_2 Cys_Met_Meta_PP Aminotran_5 OKR_DC_1
Other DBs
NCBI-ProteinID: AAS55722
GB: AY442352
UniProt: Q6T1W6
AA seq 363 aa
MIPFLDLRQINMRYQKEIQQAMNRVLESGWYILGGEVDDFERKFASYCGAKYCIGVANGL
DALTLIIRAYDIGLGDEVIVPSNTYIASILAISANGATPVLVEPDINTYNIDPLKIEEKI
TSRTKAIMVVHLYGQSCDMESINLIAKKYNLKVIEDCAQAHGAIYNGKRVGSLGDAAGFS
FYPGKNLGALGDGGAITTNDAELAERLNVLRNYGSHKKYENLFKGVNSRLDELQAAILSI
KLSYLDDDNQRRREIAAYYLEHIKNPFIHLPTVTDDKAHVWHLFVVRVKEREAFQYYLAE
QNIQTLIHYPIPPHKQKAYSEWQQESFPISEQIHSEVVSLPISPVMSREEVERVVEAVNR
YGY
Reference
  Authors
Novotny R, Pfoestl A, Messner P, Schaffer C
  Title
Genetic organization of chromosomal S-layer glycan biosynthesis loci of Bacillaceae.
  Journal
Glycoconj J 20:435-47 (2004)
DOI:10.1023/B:GLYC.0000038290.74944.65
Reference
  Authors
Schaffer C, Messner P
  Title
Surface-layer glycoproteins: an example for the diversity of bacterial glycosylation with promising impacts on nanobiotechnology.
  Journal
Glycobiology 14:31R-42R (2004)
DOI:10.1093/glycob/cwh064
Reference
  Authors
Pfoestl A, Hofinger A, Kosma P, Messner P
  Title
Biosynthesis of dTDP-3-acetamido-3,6-dideoxy-alpha-D-galactose in Aneurinibacillus thermoaerophilus L420-91T.
  Journal
J Biol Chem 278:26410-7 (2003)
DOI:10.1074/jbc.M300858200

DBGET integrated database retrieval system