KEGG   Addendum: AAS86323
Entry
AAS86323          CDS       T10000                                 
Name
(KEGG) patchoulol synthase (EC:4.2.3.70 4.2.3.87 4.2.3.93)
  KO
K15807  patchoulol/alpha-guaiene/delta-guaiene synthase [EC:4.2.3.70 4.2.3.87 4.2.3.93]
Taxonomy
TAX:28511
  Lineage
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Lamioideae; Pogostemoneae; Pogostemon
Organism
ag  Addendum (Pogostemon cablin)
SSDB
Motif
Pfam: Terpene_synth_C Terpene_syn_C_2 Terpene_synth
Other DBs
NCBI-ProteinID: AAS86323
GB: AY508730
UniProt: Q49SP3
AA seq 552 aa
MELYAQSVGVGAASRPLANFHPCVWGDKFIVYNPQSCQAGEREEAEELKVELKRELKEAS
DNYMRQLKMVDAIQRLGIDYLFVEDVDEALKNLFEMFDAFCKNNHDMHATALSFRLLRQH
GYRVSCEVFEKFKDGKDGFKVPNEDGAVAVLEFFEATHLRVHGEDVLDNAFDFTRNYLES
VYATLNDPTAKQVHNALNEFSFRRGLPRVEARKYISIYEQYASHHKGLLKLAKLDFNLVQ
ALHRRELSEDSRWWKTLQVPTKLSFVRDRLVESYFWASGSYFEPNYSVARMILAKGLAVL
SLMDDVYDAYGTFEELQMFTDAIERWDASCLDKLPDYMKIVYKALLDVFEEVDEELIKLG
APYRAYYGKEAMKYAARAYMEEAQWREQKHKPTTKEYMKLATKTCGYITLIILSCLGVEE
GIVTKEAFDWVFSRPPFIEATLIIARLVNDITGHEFEKKREHVRTAVECYMEEHKVGKQE
VVSEFYNQMESAWKDINEGFLRPVEFPIPLLYLILNSVRTLEVIYKEGDSYTHVGPAMQN
IIKQLYLHPVPY
Reference
  Authors
Deguerry F, Pastore L, Wu S, Clark A, Chappell J, Schalk M
  Title
The diverse sesquiterpene profile of patchouli, Pogostemon cablin, is correlated with a limited number of sesquiterpene synthases.
  Journal
Arch Biochem Biophys 454:123-36 (2006)
DOI:10.1016/j.abb.2006.08.006
Reference
  Authors
Faraldos JA, Wu S, Chappell J, Coates RM
  Title
Doubly deuterium-labeled patchouli alcohol from cyclization of singly labeled [2-(2)H(1)]farnesyl diphosphate catalyzed by recombinant patchoulol synthase.
  Journal
J Am Chem Soc 132:2998-3008 (2010)
DOI:10.1021/ja909251r

DBGET integrated database retrieval system