KEGG   Addendum: AAT47186
Entry
AAT47186          CDS       T10000                                 
Symbol
PAM
Name
(KEGG) phenylalanine aminomutase (L-beta-phenylalanine forming) (EC:5.4.3.10)
  KO
K20709  phenylalanine aminomutase (L-beta-phenylalanine forming) [EC:5.4.3.10]
Taxonomy
TAX:88032
  Lineage
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Pinopsida; Pinidae; Conifers II; Cupressales; Taxaceae; Taxus
Organism
ag  Addendum (Taxus canadensis)
SSDB
Motif
Pfam: Lyase_aromatic
Other DBs
NCBI-ProteinID: AAT47186
GB: AY582743
UniProt: Q6GZ04
Structure
AA seq 698 aa
MGFAVESRSHVKDILGLINTFNEVKKITVDGTTPITVAHVAALARRHDVKVALEAEQCRA
RVETCSSWVQRKAEDGADIYGVTTGFGACSSRRTNQLSELQESLIRCLLAGVFTKGCASS
VDELPATATRSAMLLRLNSFTYGCSGIRWEVMEALEKLLNSNVSPKVPLRGSVSASGDLI
PLAYIAGLLIGKPSVVARIGDDVEVPAPEALSRVGLRPFKLQAKEGLALVNGTSFATALA
STVMYDANVLLLLVETLCGMFCEVIFGREEFAHPLIHKVKPHPGQIESAELLEWLLRSSP
FQDLSREYYSIDKLKKPKQDRYALRSSPQWLAPLVQTIRDATTTVETEVNSANDNPIIDH
ANDRALHGANFQGSAVGFYMDYVRIAVAGLGKLLFAQFTELMIEYYSNGLPGNLSLGPDL
SVDYGLKGLDIAMAAYSSELQYLANPVTTHVHSAEQHNQDINSLALISARKTEEALDILK
LMIASHLTAMCQAVDLRQLEEALVKVVENVVSTLADECGLPNDTKARLLYVAKAVPVYTY
LESPCDPTLPLLLGLEQSCFGSILALHKKDGIETDTLVDRLAEFEKRLSDRLENEMTAVR
VLYEKKGHKTADNNDALVRIQGSRFLPFYRFVREELDTGVMSARREQTPQEDVQKVFDAI
ADGRITVPLLHCLQGFLGQPNGCANGVESFQSVWNKSA
Reference
  Authors
Jennewein S, Wildung MR, Chau M, Walker K, Croteau R
  Title
Random sequencing of an induced Taxus cell cDNA library for identification of clones involved in Taxol biosynthesis.
  Journal
Proc Natl Acad Sci U S A 101:9149-54 (2004)
DOI:10.1073/pnas.0403009101
Reference
  Authors
Feng L, Wanninayake U, Strom S, Geiger J, Walker KD
  Title
Mechanistic, mutational, and structural evaluation of a Taxus phenylalanine aminomutase.
  Journal
Biochemistry 50:2919-30 (2011)
DOI:10.1021/bi102067r

DBGET integrated database retrieval system