KEGG   Addendum: AAV63785
Entry
AAV63785          CDS       T10000                                 
Symbol
SES
Name
(KEGG) selinene synthase (EC:4.2.3.198)
  KO
K23172  alpha-selinene synthase [EC:4.2.3.198]
Taxonomy
TAX:39350
  Lineage
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ociminae; Ocimum
Organism
ag  Addendum (Ocimum basilicum)
SSDB
Motif
Pfam: Terpene_synth_C Terpene_synth Terpene_syn_C_2
Other DBs
NCBI-ProteinID: AAV63785
GB: AY693643
UniProt: Q5SBP7
AA seq 550 aa
MSANCVSAAPTSPKNSDVEEIRKSATYHSSVWGNHFLSYTSDVTEITAAEKEQLEKLKEK
VKNLLAQTPDESTGKMELIDAIQRLGVGYHFTTEIQESLRQIHEGQIRNDDDDVRVVALR
FRLLRQGGYRAPCDVFEKFMDDGGNFKESLKKDVEGMLSLYEASYYGIDGEEIMDKALEF
SSSHLESMLHNISTKTNKSLLRRLQEALDTPISKAAIRLGATKFISTYREDESHNEDILN
FAKLDFNILQKMHQEEANYLTRWWEDLDLASKLDFARDRMVESYFWSLGVYFQPQYRTSR
IYLTKIISIVAVIDDIYDVYGSFDDLRSFTDVIQSWKISNADELPPYMRICFEALLGIYE
DMGDRIGAPYAIDTMKELVDTYMQEAEWCYTEYVPTVDEYMKVALVTGGYLMVATTFLTG
INNITKKDFDWIRNRPRLLQVAEVLTRLMDDIAGHGTEKKTTAVSCYMKEYECSEMEASR
ELSKQVKKAWKDLNDEWMEPRSSSAEIIGCIVNMSRVLHIMYSTGDDGFSDSSTRTTQAV
KTLLVDHPMN
Reference
  Authors
Iijima Y, Davidovich-Rikanati R, Fridman E, Gang DR, Bar E, Lewinsohn E, Pichersky E
  Title
The biochemical and molecular basis for the divergent patterns in the biosynthesis of terpenes and phenylpropenes in the peltate glands of three cultivars of basil.
  Journal
Plant Physiol 136:3724-36 (2004)
DOI:10.1104/pp.104.051318

DBGET integrated database retrieval system