KEGG   Addendum: AAX07435
Entry
AAX07435          CDS       T10000                                 
Symbol
LPS
Name
(KEGG) levopimaradiene synthase/copalyl diphosphate synthase (EC:4.2.3.32 4.2.3.132)
  KO
K19571  levopimaradiene/neoabietadiene/copalyl diphosphate synthase [EC:4.2.3.32 4.2.3.132 5.5.1.12]
Taxonomy
TAX:3352
  Lineage
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Pinopsida; Pinidae; Conifers I; Pinales; Pinaceae; Pinus; Pinus subgen. Pinus
Organism
ag  Addendum (Pinus taeda)
SSDB
Motif
Pfam: Terpene_synth_C Terpene_synth Terpene_syn_C_2 SQHop_cyclase_C DUF6558
Other DBs
NCBI-ProteinID: AAX07435
GB: AY779541
UniProt: Q50EK2
AA seq 850 aa
MALPSSSLSSQIHTGATTQCIPHFHGSLNAGTSAGKRRSLYLRWGKGPSKIVACAGQDPF
SVPTLVKREFPPGFWKDHVIESLMPSYKVAPSDEKRIETLITEIKNMFRSMGYGETNPSA
YDTAWVARIPAVDGSEKPQFPETLEWILQNQLKDGSWGEEFYFLAYDRILATLACIITLT
IWQTGDTQVQKGIEFFKTQAGKIEEEADSHRPSGFEIVFPAMLKEAKALGLALPYELPFI
QQIIEKREAKLQRLPPDLLYALPTTLLYSLEGLQEIVDWEKIMKLQSKDGSFLSSPASTA
AVFMRTGNKKCLEFLNFVLKKFGNHVPCHYPLDLFERLWAVDTVERLGIDHHFKEEIKDA
LDYVYSHWDERGIGWARENPVPDIDDTAMGLRILRLHGYNVSSDVLKTFRDENGEFFCFL
GQTQRGVTDMLNVNRCSHVAFPGETIMEEAKLCTERYLRNALEDGGASDKWALKKNIRGE
VEYALKYPWHRSMPRLEARSYIENYGPNDVWLGKTMYMMPNISNEKYLELAKLDFNRVQF
FHRQELQDIRRWWNSSGFSQLGFTRERVAEIYFSPASFLFEPEFATCRAVYTKTSNFTVI
LDDLYDAHGTLDNLKLFSESVKRWDLSLVDQMPQDMKICFKGFYNTFNEIAEEGRKRQGR
DVLSYIQKVWEVQLEAYTKEAEWSAVRYVPSYDEYIGNASVSIALGTVVLISALFTGEIL
TDDILSKIGRDSRFLYLMGLTGRLVNDTKTYQAERGQGEVASAVQCYMKDHPEISEEEAL
KHVYTIMDNALDELNREFVNNRDVPDTCRRLVFETARIMQLFYMDGDGLTLSHNMEIKEH
VKNCLFQPVA
Reference
  Authors
Ro DK, Bohlmann J
  Title
Diterpene resin acid biosynthesis in loblolly pine (Pinus taeda): functional characterization of abietadiene/levopimaradiene synthase (PtTPS-LAS) cDNA and subcellular targeting of PtTPS-LAS and abietadienol/abietadienal oxidase (PtAO, CYP720B1).
  Journal
Phytochemistry 67:1572-8 (2006)
DOI:10.1016/j.phytochem.2006.01.011
Reference
  Authors
Ro DK, Arimura G, Lau SY, Piers E, Bohlmann J
  Title
Loblolly pine abietadienol/abietadienal oxidase PtAO (CYP720B1) is a multifunctional, multisubstrate cytochrome P450 monooxygenase.
  Journal
Proc Natl Acad Sci U S A 102:8060-5 (2005)
DOI:10.1073/pnas.0500825102

DBGET integrated database retrieval system