KEGG   Addendum: ABB29913
Entry
ABB29913          CDS       T10000                                 
Symbol
wfaP
Name
(KEGG) UDP-Glc:alpha-D-GlcNAc-glucosaminyl-diphosphoundecaprenol beta-1,3-glucosyltransferase (EC:2.4.1.305)
  KO
K21363  UDP-Glc:alpha-D-GlcNAc-glucosaminyl-diphosphoundecaprenol beta-1,3-glucosyltransferase [EC:2.4.1.305]
Taxonomy
TAX:562
  Lineage
Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Escherichia
Organism
ag  Addendum (Escherichia coli)
SSDB
Motif
Pfam: Glycos_transf_2 Glyco_tranf_2_2 Glyco_tranf_2_3 Glyco_tranf_2_4 SYMPK_PTA1_N
Other DBs
NCBI-ProteinID: ABB29913
GB: DQ220293
UniProt: Q077R2
AA seq 251 aa
MELVSIIIAAYNCKDTIYATVESALSQTYKNIEIIICDDSSTDDTWDIINKIKDSRIICI
KNNYCKGAAGARNCALKIAKGRYIAFLDSDDYWVTTKISNQIHFMETEKVFFSYSNYYIE
KDFVITGVFSSPPEINYGAMLKYCNIACSTVILDRTGVKNISFPYIDKEDYALWLNILSK
GIKARNTNLVDTYYRVHAGSVSANKFKELIRQSNVLKSIGIKAHHRIICLFYYAINGLIK
HCFSYRDKRNA
Reference
  Authors
Cheng J, Wang Q, Wang W, Wang Y, Wang L, Feng L
  Title
Characterization of E. coli O24 and O56 O antigen gene clusters reveals a complex evolutionary history of the O24 gene cluster.
  Journal
Curr Microbiol 53:470-6 (2006)
DOI:10.1007/s00284-006-0032-7
Reference
  Authors
Brockhausen I, Hu B, Liu B, Lau K, Szarek WA, Wang L, Feng L
  Title
Characterization of two beta-1,3-glucosyltransferases from Escherichia coli serotypes O56 and O152.
  Journal
J Bacteriol 190:4922-32 (2008)
DOI:10.1128/JB.00160-08

DBGET integrated database retrieval system