KEGG   Addendum: ABI15166
Entry
ABI15166          CDS       T10000                                 
Symbol
aknOx
Name
(KEGG) bifunctional aclacinomycin-N/aclacinomycin-A oxidase (EC:1.1.3.45 1.3.3.14)
  KO
K15949  aclacinomycin-N/aclacinomycin-A oxidase [EC:1.1.3.45 1.3.3.14]
Taxonomy
TAX:33899
  Lineage
Bacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces
Organism
ag  Addendum (Streptomyces galilaeus)
SSDB
Motif
Pfam: FAD_binding_4 BBE TAT_signal
Other DBs
NCBI-ProteinID: ABI15166
GB: AF257324
UniProt: Q0PCD7
Structure
AA seq 545 aa
MFVLNEFTRRGFLGTAAAVGGTTVVTTALGGAPAAQAAVPEAADGGACGARTALVKVDRV
DRRYQDLVTRGFNGRFRGRPDVVYVVHTADQVVDAVNQAMAAGQRIAVRSGGHCFEGFVD
DPAVRAVIDMSQMRQVFYDSGKRAFAVEPGATLGETYRALYLDWGVTIPAGVCPQVGVGG
HVLGGGYGPLSRRDGVVADHLYAVEVVVVDASGRARKVVATSAADDPNRELWWAHTGGGG
GNFGIVTRYWFRTPGATGTDPSQLLPKAPTSTLRHIVTWDWSALTEEAFTRIIDNHGAWH
QSNSAAGTPYASMHSVFYLNSRAAGQILLDIQIDGGLDGAEALLNDFVAAVNEGTGVEPA
VQRSTEPWLRATLANKFDTGGFDRTKSKGAYLRKPWTAAQAATLYRHLSADSQVWGEVSL
YSYGGKVNSVPETATATAQRDSIIKVWMSATWMDPAHDDANLAWIREIYREIFATTGGVP
VPDDRTEGTFINYPDVDLVDERWNTSGVPWYTLYYKGNYPRLQKVKARWDPRDVFRHALS
VRPPG
Reference
  Authors
Raty K, Kantola J, Hautala A, Hakala J, Ylihonko K, Mantsala P
  Title
Cloning and characterization of Streptomyces galilaeus aclacinomycins polyketide synthase (PKS) cluster.
  Journal
Gene 293:115-22 (2002)
DOI:10.1016/S0378-1119(02)00699-6
Reference
  Authors
Alexeev I, Sultana A, Mantsala P, Niemi J, Schneider G
  Title
Aclacinomycin oxidoreductase (AknOx) from the biosynthetic pathway of the antibiotic aclacinomycin is an unusual flavoenzyme with a dual active site.
  Journal
Proc Natl Acad Sci U S A 104:6170-5 (2007)
DOI:10.1073/pnas.0700579104

DBGET integrated database retrieval system