KEGG   Addendum: ABO84854
Entry
ABO84854          CDS       T10000                                 

Symbol
CYP71AJ4
Name
(KEGG) angelicin synthase (EC:1.14.14.148)
  KO
K21715  angelicin synthase [EC:1.14.14.148]
Taxonomy
TAX:4041
  Lineage
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiaceae; Apioideae; apioid superclade; Tordylieae; Tordyliinae; Pastinaca
Organism
ag  Addendum (Pastinaca sativa)
SSDB
Motif
Pfam: p450
Other DBs
NCBI-ProteinID: ABO84854
GB: EF191021
UniProt: C0SJS3
AA seq 478 aa
YFFSLFLVTIFLYKWLAKKTPSKNLPPSPPRLPIIGNLHQIGPDLHISLRDLARKYGPLM
QLQLGRIPVLVVSSAEATREVLKTHDVVFSQRPITSAIDKLCYKGRDVAFSRYSEYWRQV
RSTCVTQLLSNSRVHSFHNIREEEVALLIQNIENSASEVINLGEQLIQLTRNVVCRVSVG
SEYLSGHKGKLYQKLLAEVTEMLAYTYSIGDFIPLLGWVDWLSGSKAKVEKTAKEVDAFL
EGALRDHIKTMASNKGSANDDFLSILLEIREADAGSTLDEECIKAIVWDMILGGTETTST
TLEWIVAAIIKNPDVMFKLQKEVREIGKGKSKIEEVDLVKMNYLKAVMKESMRLYITAFL
LPREAKQDVKLMGYDISSGTQVLINTWETARDPSLWDNPEEFRPERFLNSPIDYKGLHYE
YLPFGGGRRGCPGIQFAMAVNELAVANVVYKFDFKMPDGERFEDLDMSGVPGISLYRK
Reference
  Authors
Larbat R, Hehn A, Hans J, Schneider S, Jugde H, Schneider B, Matern U, Bourgaud F
  Title
Isolation and functional characterization of CYP71AJ4 encoding for the first P450 monooxygenase of angular furanocoumarin biosynthesis.
  Journal
J Biol Chem 284:4776-85 (2009)
DOI:10.1074/jbc.M807351200

DBGET integrated database retrieval system