KEGG   Addendum: ABV56598
Entry
ABV56598          CDS       T10000                                 

Symbol
ktzR
Name
(KEGG) 7-chloro-L-tryptophan 6-halogenase (EC:1.14.19.60)
  KO
K22695  7-chloro-L-tryptophan 6-halogenase [EC:1.14.19.60]
Taxonomy
TAX:345341
  Lineage
Bacteria; Actinobacteria; Pseudonocardiales; Pseudonocardiaceae; Kutzneria; unclassified Kutzneria
Organism
ag  Addendum (Kutzneria sp. 744)
SSDB
Motif
Pfam: Trp_halogenase
Other DBs
NCBI-ProteinID: ABV56598
GB: EU074211
UniProt: A8CF74
AA seq 505 aa
MTAAYLKTAFGDRLSITVVESSRIGTIGVGEATFSDIQHFFQFLNLREQDWMPACNATYK
LGIRFENWRHVGHHFYQPFEQIRPVYGFPLTDWWLHDAPTDRFDTDCFVMPNLCEAGRSP
RHLDGTLADEDFVEEGDELANRTMSEHQGKSQFPYAYHFEAALLAKFLTGYAVDRGVEHV
VDDVLDVRLDQRGWIEHVVTAEHGEIHGDLFVDCTGFRGLLLNKALGVPFVSYQDTLPND
SAVALQVPLDMQRRGIVPNTTATAREAGWIWTIPLFGRVGTGYVYAKDYLSPEEAERTLR
EFVGPAAADVEANHIRMRIGRSQESWRNNCVAIGLSSGFVEPLESTGIFFIHHAIEQLVK
HFPAADWNPKSRDMYNSAVAHVMDGIREFLVIHYRGAARADNQYWRDTKTRPLPDGLAER
IECWQTQLPDTETIYPYYHGLPPYSYMCILMGGGAIRTPASAALALTDQGAAQKEFAAVR
DRAAQLRDTLPSHYEYLARMRGLDV
Reference
  Authors
Fujimori DG, Hrvatin S, Neumann CS, Strieker M, Marahiel MA, Walsh CT
  Title
Cloning and characterization of the biosynthetic gene cluster for kutznerides.
  Journal
Proc Natl Acad Sci U S A 104:16498-503 (2007)
DOI:10.1073/pnas.0708242104
Reference
  Authors
Heemstra JR Jr, Walsh CT
  Title
Tandem action of the O2- and FADH2-dependent halogenases KtzQ and KtzR produce 6,7-dichlorotryptophan for kutzneride assembly.
  Journal
J Am Chem Soc 130:14024-5 (2008)
DOI:10.1021/ja806467a

DBGET integrated database retrieval system