KEGG   Addendum: ABZ89566
Entry
ABZ89566          CDS       T10000                                 
Symbol
OMT2
Name
(KEGG) xanthohumol 4-O-methyltransferase (EC:2.1.1.339)
  KO
K21582  xanthohumol 4'-O-methyltransferase [EC:2.1.1.339]
Taxonomy
TAX:3486
  Lineage
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Humulus
Organism
ag  Addendum (Humulus lupulus)
SSDB
Motif
Pfam: Methyltransf_2 Dimerisation Penicillinase_R Methyltransf_PK
Other DBs
NCBI-ProteinID: ABZ89566
GB: EU309726
UniProt: B0ZB56
AA seq 360 aa
MELARNDQTEAALRGEANVWKSINGIADFMVMKCALELRIPDIVHSHSAPITLAQIASSV
PDSPSLNLSYLSRIMRLLVRRKIFSQHKSLDGEEVLYGPTHSSRLLLSKTTLPDQVTLAP
FVAFMTHPYLSAPWSCLARCVKEGGNGFEMVHGGRQLWDLSPGNPEFNKVFNDGMASTAR
ITTMAILSEYRDVFCGICSLVDVGGEFGGSISAIVKSHPHIKGINYDLPHVVATAPTYTG
LVSHVGGNMFEWIPTAVAVFMKWILHDWADEDCVKILKNCRRAMPEKGGKIIIVDIVLEP
EGNGLFDDAAVMLDIALMALTRGKERTEKEWKRVLEEGGFPRYQILKIPALTSVIEAYPQ
Reference
  Authors
Nagel J, Culley LK, Lu Y, Liu E, Matthews PD, Stevens JF, Page JE
  Title
EST analysis of hop glandular trichomes identifies an O-methyltransferase that catalyzes the biosynthesis of xanthohumol.
  Journal
Plant Cell 20:186-200 (2008)
DOI:10.1105/tpc.107.055178

DBGET integrated database retrieval system