KEGG   Addendum: ACA24822
Entry
ACA24822          CDS       T10000                                 
Symbol
wfgD
Name
(KEGG) UDP-Glc:alpha-D-GlcNAc-glucosaminyl-diphosphoundecaprenol beta-1,3-glucosyltransferase (EC:2.4.1.305)
  KO
K21363  UDP-Glc:alpha-D-GlcNAc-glucosaminyl-diphosphoundecaprenol beta-1,3-glucosyltransferase [EC:2.4.1.305]
Taxonomy
TAX:562
  Lineage
Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Escherichia
Organism
ag  Addendum (Escherichia coli)
SSDB
Motif
Pfam: Glycos_transf_2 Glyco_tranf_2_2 Glyco_tranf_2_3 Glyco_tranf_2_4 DUF3144 Tab2-like_N
Other DBs
NCBI-ProteinID: ACA24822
GB: EU294170
UniProt: B5L3F2
AA seq 253 aa
MDDYLVSIIMPSYNAEHTISASISSVLKQTYANWELLVCDDDSSDNTRFKVLEFSDSRIK
LLTNEYAKGAAGARNTALKYASGRFIAFLDSDDIWIANKLEMQISMMLKNNISFMYGNYE
IINNNSIVGKFVAPQKITYNKLLKNCGIGCLTVVLDRTLLNPFSFPFVHKEDYYLWLSIL
KDNNISAINCGFICSKYRLSQSSISSNKFKELKRQWDVLGDFVENPLARIYYLLNYIVIG
IKKHAFDYKNGKK
Reference
  Authors
Liu B, Knirel YA, Feng L, Perepelov AV, Senchenkova SN, Wang Q, Reeves PR, Wang L
  Title
Structure and genetics of Shigella O antigens.
  Journal
FEMS Microbiol Rev 32:627-53 (2008)
DOI:10.1111/j.1574-6976.2008.00114.x
Reference
  Authors
Brockhausen I, Hu B, Liu B, Lau K, Szarek WA, Wang L, Feng L
  Title
Characterization of two beta-1,3-glucosyltransferases from Escherichia coli serotypes O56 and O152.
  Journal
J Bacteriol 190:4922-32 (2008)
DOI:10.1128/JB.00160-08

DBGET integrated database retrieval system