KEGG   Addendum: ACG70826
Entry
ACG70826          CDS       T10000                                 

Gene name
fom3
Definition
(KEGG) 2-hydroxyethylphosphonate methyltransferase (EC:2.1.1.308)
  KO
K12902  phosphonoacetaldehyde methylase [EC:2.1.1.308]
Taxonomy
TAX:1906
  Lineage
Bacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces
Organism
ag  Addendum (Streptomyces fradiae)
SSDB
Motif
Pfam: B12-binding Radical_SAM Fer4_14
Other DBs
NCBI-ProteinID: ACG70826
GB: EU924263
UniProt: D2SNF5
AA seq 534 aa
MTIGSLGSTEFALHGKPAIRWGDLPQRVGKKASRRYQKVLLLNPSATLFRHDLPRCTYPL
GLGYIAAVLEKYDYEVKILDVFAEGYYNAQPVDGDEQFLRYGLSDDDIVKVIKEFAPDVI
GISSIFSNQADNVHHLLKLADLVAPEAVTSIGGAHARYFPKACLDDPNLDAVFLGEGEMT
FLLWLEHLNGNVREDEVHGIAWRDRDGKIQIKPELPLISSMRPEGPEQGKSSPMLSMAGE
LDHIPFPAWHHYNMEKYFEIKAYQSPYTVGSRVGQLYTSRGCTAHCTFCTTTHFWGQKLR
RRSVDNVVNEVLRLRDEYGIDEFHIQDDNITNDMDHARELFRAFKEVGLPWATPQGTALW
RMDEELLDLMAESGAYQVTFAIESGVQRVLKDLIKKPLNLGRTSHLIKYARSLGMHVHGF
FIIGMPPMFGNAGESIEEMQASYDYAEESGFSSASFFAASPIVGSELLRECIRQGFVDPE
ESLYRMTYKQGIINVPGLWDGEEIAELAAKFNRDFNARRDRDYTPQKQWNANQY
Reference
  Authors
Woodyer RD, Li G, Zhao H, van der Donk WA
  Title
New insight into the mechanism of methyl transfer during the biosynthesis of fosfomycin.
  Journal
Chem Commun (Camb) 359-61 (2007)
DOI:10.1039/b614678c

DBGET integrated database retrieval system