KEGG   Addendum: ACH97149
Entry
ACH97149          CDS       T10000                                 
Symbol
wclR
Name
(KEGG) UDP-Gal:alpha-D-GlcNAc-diphosphoundecaprenol alpha-1,3-galactosyltransferase (EC:2.4.1.343)
  KO
K24654  O3-antigen biosynthesis alpha-1,3-galactosyltransferase [EC:2.4.1.343]
Taxonomy
TAX:562
  Lineage
Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Escherichia
Organism
ag  Addendum (Escherichia coli)
SSDB
Motif
Pfam: Glycos_transf_1 Glyco_trans_1_4 Glyco_transf_4 Glyco_trans_4_4 Glyco_trans_4_2 PIGA
Other DBs
NCBI-ProteinID: ACH97149
GB: EU694097
UniProt: B5T072
AA seq 387 aa
MKSTHSKIKIAHVQLMPLLSGVQRVSLQEFELLPNEQFDINLICKESGPLTDYLDDSVRA
FFVPTLCRNISLIKDMKSLISLYKLLKKEKYDIVHTHSSKTGILGRIAARLAGVPCVVHT
VHGFAFESTKRKSVKLVYKWLEIFAAKCTTRLICLHNEDKEICIKELYVDPMKISVIPNG
VDLEKFAPAINKGDLKEKILGLKRNSFVFTMVGRLWPQKNPLYFAEAAKYIIENNLIPDS
VFVIVGDGELMNDLKYNYQTDMNLKKRLLLLGWRNDIPNILKASDVFVLPSLWEGMPLAI
LEAQSTGLPCIVSNINGNNCLVKNEFDGFLIELNDIDSFINALVRVTDDKVLNIMSKNCR
NKIVNGFNIVKRVDKIKDLYIDMVVNK
Reference
  Authors
Ren Y, Liu B, Cheng J, Liu F, Feng L, Wang L
  Title
Characterization of Escherichia coli O3 and O21 O antigen gene clusters and development of serogroup-specific PCR assays.
  Journal
J Microbiol Methods 75:329-34 (2008)
DOI:10.1016/j.mimet.2008.07.010
Reference
  Authors
Chen C, Liu B, Xu Y, Utkina N, Zhou D, Danilov L, Torgov V, Veselovsky V, Feng L
  Title
Biochemical characterization of the novel alpha-1, 3-galactosyltransferase WclR from Escherichia coli O3.
  Journal
Carbohydr Res 430:36-43 (2016)
DOI:10.1016/j.carres.2016.04.012

DBGET integrated database retrieval system