KEGG   Addendum: ACJ38409
Entry
ACJ38409          CDS       T10000                                 
Symbol
SBS
Name
(KEGG) santalene and bergamotene synthase (EC:4.2.3.50 4.2.3.53 4.2.3.54)
  KO
K15798  santalene and bergamotene synthase [EC:4.2.3.50 4.2.3.53 4.2.3.54]
Taxonomy
TAX:62890
  Lineage
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Solanum subgen. Lycopersicon
Organism
ag  Addendum (Solanum habrochaites)
SSDB
Motif
Pfam: Terpene_synth_C Terpene_synth Terpene_syn_C_2 Prenyltrans Leuk-A4-hydro_C CdiA_C PYRIN
Other DBs
NCBI-ProteinID: ACJ38409
GB: FJ194970
UniProt: B8XA41
AA seq 777 aa
MIVGYRSTIITLSHPKLGNGKTISSNAIFQRSCRVRCSHSTPSSMNGFEDARDRIRESFG
KVELSPSSYDTAWVAMVPSKHSLNEPCFPQCLDWIIENQREDGSWGLNPSHPLLLKDSLS
STLACLLALTKWRVGDEQIKRGLGFIETQSWAIDNKDQISPLGFEIIFPSMIKSAEKLNL
NLAINKRDSTIKRALQNEFTRNIEYMSEGVGELCDWKEIIKLHQRQNGSLFDSPATTAAA
LIYHQHDKKCYEYLNSILQQHKNWVPTMYPTKIHSLLCLVDTLQNLGVHRHFKSEIKKAL
DEIYRLWQQKNEQIFSNVTHCAMAFRLLRMSYYDVSSDELAEFVDEEHFFAISGKYTSHV
EILELHKASQLAIDHEKDDILDKINNWTRTFMEQKLLNNGFIDRMSKKEVELALRKFYTI
SDLAENRRCIKSYEENNFKILKAAYRSPNIYNKDLFIFSIRNFELCQAQHQEELQQFKRW
FEDYRLDQLGIAERYIHDTYLCAVIVVPEPELSDARLLYAKYVLLLTIVDDQFDSFASTD
ECLNIIELVERWDDYASVGYKSEKVKVFFSTLYKSIEELVTIAEIKQGRSVKNHLLNLWL
ELVKLMLMERVEWFSGKTIPSIEEYLYVTSITFGARLIPLTTQYFLGIKISEDILESDEI
YGLCNCTGRVLRILNDLQDSKKEQKEDSVTIVTLLMKSMSEEEAIMKIKEILEMNRRELL
KMVLVQKKGSQLPQICKDIFWRTSNWADFIYLQTDGYRIAEEMKNHIDEVFYKPLNH
Comment
Unpublished sequence data: Sallaud C, Rontein D, Onillon S, Jabes F, Duffe P, Giacalone C, Thoraval S, Escoffier C, Herbette G, Leonhardt N, Causse M, Tissier A (2008).
Reference
  Authors
Sallaud C, Rontein D, Onillon S, Jabes F, Duffe P, Giacalone C, Thoraval S, Escoffier C, Herbette G, Leonhardt N, Causse M, Tissier A
  Title
A novel pathway for sesquiterpene biosynthesis from Z,Z-farnesyl pyrophosphate in the wild tomato Solanum habrochaites.
  Journal
Plant Cell 21:301-17 (2009)
DOI:10.1105/tpc.107.057885

DBGET integrated database retrieval system