KEGG   Addendum: ACY38197
Entry
ACY38197          CDS       T10000                                 
Symbol
C4
Name
(KEGG) delta-guaiene synthase (EC:4.2.3.87 4.2.3.93)
  KO
K22036  alpha/delta-guaiene synthase [EC:4.2.3.87 4.2.3.93]
Taxonomy
TAX:223751
  Lineage
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Thymelaeaceae; Aquilaria
Organism
ag  Addendum (Aquilaria crassna)
SSDB
Motif
Pfam: Terpene_synth_C Terpene_syn_C_2 Terpene_synth
Other DBs
NCBI-ProteinID: ACY38197
GB: GU083699
UniProt: D0VMR8
AA seq 547 aa
MSSAKLGSASEDVSRRDANYHPTVWGDFFLTHSSDFLENNDSILEKHEELKQEVRNLLVV
ETSDLPSKIQLTDDIIRLGVGYHFETEIKAQLEKLHDHQLHLNFDLLTTSVWFRLLRGHG
FSISSDVFKRFKNTKGEFETEDARTLWCLYEATHLRVDGEDILEEAIQFSRKKLEALLPE
LSFPLNECVRDALHIPYHRNVQRLAARQYIPQYDAEPTKIESLSLFAKIDFNMLQALHQR
ELREASRWWKEFDFPSKLPYARDRIAEGYYWMMGAHFEPKFSLSRKFLNRIIGITSLIDD
TYDVYGTLEEVTLFTEAVERWDIEAVKDIPKYMQVIYIGMLGIFEDFKDNLINARGKDYC
IDYAIEVFKEIVRSYQREAEYFHTGYVPSYDEYMENSIISGGYKMFIILMLIGRGEFELK
ETLDWASTIPEMVKASSLIARYIDDLQTYKAEEERGETVSAVRCYMREYDVSEEEACKKM
REMIEIEWKRLNKTTLEADEVSSSVVIPSLNFTRVLEVMYDKGDGYSDSQGVTKDRIAAL
LRHAIEI
Reference
  Authors
Kumeta Y, Ito M
  Title
Characterization of delta-guaiene synthases from cultured cells of Aquilaria, responsible for the formation of the sesquiterpenes in agarwood.
  Journal
Plant Physiol 154:1998-2007 (2010)
DOI:10.1104/pp.110.161828

DBGET integrated database retrieval system