KEGG   Addendum: ACZ66247
Entry
ACZ66247          CDS       T10000                                 
Symbol
bgpA
Name
(KEGG) ginsenosidase type III (EC:3.2.1.191)
  KO
K20836  ginsenosidase type III [EC:3.2.1.191]
Taxonomy
TAX:490575
  Lineage
Bacteria; Actinobacteria; Micrococcales; Intrasporangiaceae; Terrabacter
Organism
ag  Addendum (Terrabacter ginsenosidimutans)
SSDB
Motif
Pfam: Glyco_hydro_3 Glyco_hydro_3_C
Other DBs
NCBI-ProteinID: ACZ66247
GB: GU196785
UniProt: D2KAT1
AA seq 648 aa
MTMITPSYLGETIEYSSLHACRSTLEDPTPSRRKAPPVRPELHTTEDGVAYRDLNGNGRM
DPYEDPRLPVEVRVEDLLGRLSLEEKVGLMFQTVIEAGSDGTVLEHPGSISKSPTSTVVL
DKHLTHFNVHALDDPRMAARWSNALQALAERTPHGIPVTVSTDPRHAFIENVGVSFSAGA
FSQWPEPLGLAALRDADAVRRFADIARQEYVAVGIRAALHPTLDLATEPRWARQAGTFGQ
DPDLVTELGVAYLKGFQGDSLGSGSVACTSKHFPGGGPQKDGEDAHFPYGREQVYPGGRF
ADHLKPFPPIIEAGTAGIMPYYGMPVDLVVDGVEIEPIGFGYNKQVVTGLLREKLGYDGV
VVTDWELVNDNHVGDQVLPARAWGVEHLDPHGRMELILEAGADQFGGEECVEILLDLVAQ
GRVTEARVDESARRILAVKFRLGLFENPYVDEDEAAATVGRDDFREEGYAAQARSVTVLH
HEGGRLPLEHGLRIYAEQVSPEAVARHGKLVDRPEDADVAVVRLTAPFDPRSDLFLESWF
HQGSLDFPPGLVARLERIAAVCPLVVDVVLDRPAVLTPLLRFASAVVGSFGSCDDALLDA
LTGTIAPVGRLPFDLPRSMDQVRAHGEDVPGYDDPLFPFGHGLRLDTE
Reference
  Authors
An DS, Cui CH, Lee HG, Wang L, Kim SC, Lee ST, Jin F, Yu H, Chin YW, Lee HK, Im WT, Kim SG
  Title
Identification and characterization of a novel Terrabacter ginsenosidimutans sp. nov. beta-glucosidase that transforms ginsenoside Rb1 into the rare gypenosides XVII and LXXV.
  Journal
Appl Environ Microbiol 76:5827-36 (2010)
DOI:10.1128/AEM.00106-10
Reference
  Authors
Jin XF, Yu HS, Wang DM, Liu TQ, Liu CY, An DS, Im WT, Kim SG, Jin FX
  Title
Kinetics of a cloned special ginsenosidase hydrolyzing 3-O-glucoside of multi-protopanaxadiol-type ginsenosides, named ginsenosidase type III.
  Journal
J Microbiol Biotechnol 22:343-51 (2012)
DOI:10.4014/jmb.1107.07066

DBGET integrated database retrieval system