KEGG   Addendum: ADB04310
Entry
ADB04310          CDS       T10000                                 
Symbol
bnsA
Name
(KEGG) naphthyl-2-oxomethyl-succinyl-CoA thiolase subunit
  KO
K15574  naphthyl-2-oxomethyl-succinyl-CoA thiolase subunit [EC:2.3.1.-]
Taxonomy
TAX:700510
  Lineage
Bacteria; environmental samples
Organism
bacterium enrichment culture clone N47
SSDB
Motif
Pfam: OB_aCoA_assoc DUF35_N
Other DBs
NCBI-ProteinID: ADB04310
GB: GU080111
UniProt: D2XBJ1
AA seq 131 aa
IIFYHPDLFEVPEDGSPPYLKGYKCKKCGHIDFPKPDLCFKCWEEEFDIVRLSTKGKLYA
PSDIYIGQPGMKTPYTIGYVDLPENVRVFAQLDGETGSFKCDEEVELTTGTIRMNADGLP
VTSYKFRKLIS
Comment
Incomplete sequence.
Reference
  Authors
Selesi D, Jehmlich N, von Bergen M, Schmidt F, Rattei T, Tischler P, Lueders T, Meckenstock RU
  Title
Combined genomic and proteomic approaches identify gene clusters involved in anaerobic 2-methylnaphthalene degradation in the sulfate-reducing enrichment culture N47.
  Journal
J Bacteriol 192:295-306 (2010)
DOI:10.1128/JB.00874-09

DBGET integrated database retrieval system