KEGG   Addendum: ADK73618
Entry
ADK73618          CDS       T10000                                 
Symbol
TPS4
Name
(KEGG) bicyclogermacrene synthase (EC:4.2.3.100)
  KO
K21980  bicyclogermacrene synthase [EC:4.2.3.100]
Taxonomy
TAX:39352
  Lineage
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Origanum
Organism
ag  Addendum (Origanum vulgare)
SSDB
Motif
Pfam: Terpene_synth_C Terpene_synth Terpene_syn_C_2
Other DBs
NCBI-ProteinID: ADK73618
GB: GU385973
UniProt: E2E2N7
AA seq 555 aa
MEIYSPVVPAVKDVKRLDEIRKSAKFHPSIWGDFFLSYNSDNTQISEAEEEEVAKQKEAV
RELLAQVPEGSTYKMELIDLIQRLGVNYHFEKEIHDSLNYIHENSQHNDDEVRTTALRFR
LLRQQGYRVPCDVFRKFTDGEGNFATALTNDVEGLLELYEASHLATRGEEILDRAMEFSS
SHLQALLNQHLVGSVSLSKRVDEALKMPIRKTLTRLGARKFISLYQEDESRNELLLNFAK
LDFNMVQKMHQRELSDATRWWKKLEVAKRMPYARDRVVECFFWIVGVYFEPCYATARRIL
SKAINMASIVDDTYEYATLDELQILTDAIQRWDVNETLEDSPPHVQMCYKALIQAYAEIE
DEVVENFGGEELYRVQYAIEHVKQSAVAFFEEAKWIYNNSIPTVEEYMKVAFVTCGYMML
STTSLVGVGSDRVSKADFDWIVNEPLIVRASCVICRLMDDLVGDEYEEKPSSVLCYMKQY
VVSKDEARARLEQQVKDAWKDMNEECIEPRPASMQILTRVLNLGRVIHLLYREGDSYTDP
NRSKEWVKMVFVDPI
Reference
  Authors
Crocoll C, Asbach J, Novak J, Gershenzon J, Degenhardt J
  Title
Terpene synthases of oregano (Origanum vulgare L.) and their roles in the pathway and regulation of terpene biosynthesis.
  Journal
Plant Mol Biol 73:587-603 (2010)
DOI:10.1007/s11103-010-9636-1

DBGET integrated database retrieval system