KEGG   Addendum: ADN39488
Entry
ADN39488          CDS       T10000                                 

Symbol
ddaF
Name
(KEGG) dapdiamide A synthase (EC:6.3.2.47)
  KO
K22114  dapdiamide synthase [EC:6.3.2.47]
Taxonomy
TAX:549
  Lineage
Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Erwiniaceae; Pantoea; Pantoea agglomerans group
Organism
ag  Addendum (Pantoea agglomerans)
SSDB
Motif
Pfam: ATP-grasp_4 GARS_A ATP-grasp_3 RimK LAL_C2 CPSase_L_D2 ATPgrasp_Ter GSH-S_ATP
Other DBs
NCBI-ProteinID: ADN39488
GB: HQ130277
UniProt: E2JA31
AA seq 424 aa
MSILNNKEVIVIIDAWSGGKHLIPAFQALGYFCLHVQSTFLPEVFIADNQLAIARSDRHI
VHDGNIETLLSQLQPYTIKAILAGSEGAVGLADCLNDALELTFSNQFELSAARRNKYLMQ
EQLALKGVASINQQLAGHSDELKQWLAGHAHWPVVLKPIQSAGTDGVFICHDLAQALQAF
EAILAKKDFFGSPNREVLCQEFLAGEEFVVNGIACQGEYFFTELWQSKKQQRNGFPVYET
QYLHYQNDAGFDVLTAYTVQVCQTLGINNGAFHAEVMMTSGGPVLIEIGARVAGGADPYI
IEECLGHSQISKLAQAVLHPAKFLQECRRQHDFSGHRRAAYVYMISPSPGRVQVSPEEKF
IKIDGVISINYHYAPGDIQQETCDLLSSPGVIIAIRDNPALLKQTIAEIRDVEADFYHLG
LIDE
Reference
  Authors
Hollenhorst MA, Clardy J, Walsh CT
  Title
The ATP-dependent amide ligases DdaG and DdaF assemble the fumaramoyl-dipeptide scaffold of the dapdiamide antibiotics.
  Journal
Biochemistry 48:10467-72 (2009)
DOI:10.1021/bi9013165
Reference
  Authors
Dawlaty J, Zhang X, Fischbach MA, Clardy J
  Title
Dapdiamides, tripeptide antibiotics formed by unconventional amide ligases.
  Journal
J Nat Prod 73:441-6 (2010)
DOI:10.1021/np900685z
Reference
  Authors
Hollenhorst MA, Bumpus SB, Matthews ML, Bollinger JM Jr, Kelleher NL, Walsh CT
  Title
The nonribosomal peptide synthetase enzyme DdaD tethers N(beta)-fumaramoyl-l-2,3-diaminopropionate for Fe(II)/alpha-ketoglutarate-dependent epoxidation by DdaC during dapdiamide antibiotic biosynthesis.
  Journal
J Am Chem Soc 132:15773-81 (2010)
DOI:10.1021/ja1072367

DBGET integrated database retrieval system