KEGG   Addendum: ADO32602
Entry
ADO32602          CDS       T10000                                 

Gene name
tal
Definition
(KEGG) dTDP-6-deoxy-L-talose 4-dehydrogenase [NAD(P)+] (EC:1.1.1.344)
  KO
K19652  dTDP-6-deoxy-L-talose 4-dehydrogenase [NAD(P)+] [EC:1.1.1.344]
Taxonomy
TAX:58351
  Lineage
Bacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Kitasatospora
Organism
ag  Addendum (Kitasatospora kifunensis)
SSDB
Motif
Pfam: Epimerase GDP_Man_Dehyd RmlD_sub_bind NAD_binding_10 NAD_binding_4 3Beta_HSD ApbA adh_short Semialdhyde_dh KR
Other DBs
NCBI-ProteinID: ADO32602
GB: HM132058
UniProt: E5F146
AA seq 318 aa
MTAPHTAPARVAVLGGTGFIGRVLGARLLAQGAEVLSLARKAPAEPAPGRFVAFDLSNGD
PAELTALLDRERIDTVVNAAGGMWGLNDEQMYQANVVLTERLIEAVAAMASPARLVHLGT
VHEYGMAPVGTSQRESDPAAPVMEYGKLKLAATEAVVRAVEAGRISGVVLRLGNVVGAGQ
PGHSLLGVMAAKLDAARAAGETAQLSLQPLTALRDFVDLTDTLDAVLLAAADRSAPPVVN
VGTGSASTARHLVELLIEESGVPTEITEVPAPDGTGPETEWQQLDVTVARDSLGWTPRRT
LREAVRELWTAQSTAPVA
Reference
  Authors
Karki S, Yoo HG, Kwon SY, Suh JW, Kwon HJ
  Title
Cloning and in vitro characterization of dTDP-6-deoxy-L-talose biosynthetic genes from Kitasatospora kifunensis featuring the dTDP-6-deoxy-L-lyxo-4-hexulose reductase that synthesizes dTDP-6-deoxy-L-talose.
  Journal
Carbohydr Res 345:1958-62 (2010)
DOI:10.1016/j.carres.2010.07.004

DBGET integrated database retrieval system