KEGG   Addendum: ADP00410
Entry
ADP00410          CDS       T10000                                 

Symbol
NMT
Name
(KEGG) 3-hydroxy-16-methoxy-2,3-dihydrotabersonine N-methyltransferase (EC:2.1.1.99)
  KO
K21896  3-hydroxy-16-methoxy-2,3-dihydrotabersonine N-methyltransferase [EC:2.1.1.99]
Taxonomy
TAX:4058
  Lineage
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Organism
ag  Addendum (Catharanthus roseus)
SSDB
Motif
Pfam: Methyltransf_11 Methyltransf_25 Methyltransf_31 CMAS Methyltransf_23 Methyltransf_12 Ubie_methyltran Methyltransf_15 MetW NAS DREV MTS Methyltransf_4 Methyltransf_2 ADH_zinc_N DOT1 UPF0020 Rsm22 N-glycanase_N CheR
Other DBs
NCBI-ProteinID: ADP00410
GB: HM584929
UniProt: W5U2K2
AA seq 295 aa
KTYNNTMEEKQEKVAEFYDKVTGAWDLFYGVHLHDGYYEPGTTATMAISQDAVIRMIDEL
LRFAGVSEDPAKKPRSMLDVGSGLGGTCVYVAKKYDIQCTGITISPNQVKYAQDYAATEG
VENKVSFDCGDALDMPYSDGKFDVVFTINCIKHVHDKEKFIREMVRVAAPGAAIIIASQA
HPNLSPGESLKPRDKKILQKICDGAGAVSLCSSDDYVRWLTPLPVKEIKAADWTQNITPL
YPLLMKEAFTWKGFTSIVLKGGWRAINLINAVRLVAKAANDGILKFAVVTGRKSI
Reference
  Authors
Liscombe DK, Usera AR, O'Connor SE
  Title
Homolog of tocopherol C methyltransferases catalyzes N methylation in anticancer alkaloid biosynthesis.
  Journal
Proc Natl Acad Sci U S A 107:18793-8 (2010)
DOI:10.1073/pnas.1009003107
Reference
  Authors
De Luca V, Cutler AJ
  Title
Subcellular Localization of Enzymes Involved in Indole Alkaloid Biosynthesis in Catharanthus roseus.
  Journal
Plant Physiol 85:1099-102 (1987)
DOI:10.1104/pp.85.4.1099

DBGET integrated database retrieval system