KEGG   Addendum: ADY15026
Entry
ADY15026          CDS       T10000                                 

Symbol
STOX
Name
(KEGG) (S)-tetrahydroprotoberberine oxidase
  KO
K22089  tetrahydroprotoberberine oxidase [EC:1.3.3.8]
Taxonomy
TAX:258211
  Lineage
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; Ranunculales; Berberidaceae; Berberidoideae; Berberis
Organism
ag  Addendum (Berberis wilsoniae)
SSDB
Motif
Pfam: FAD_binding_4 BBE
Other DBs
NCBI-ProteinID: ADY15026
GB: HQ116697
UniProt: F1BVB6
AA seq 530 aa
MSKMASSIFATFSLLSSLLPTSLASSDANYEDFLQCLDLYSQNSIPVYTRNTSSYTSILE
STIKNLVFLSPTTPKPNFIVTPMQESHVQTSVICCRMHGLQMRIRSGGHDFEGLSYVSNV
PFVVLDLIHLKTINVDIEENSAWVQTGATIGELYYRIAEKVGVHAFPAGLCPTVGVGGHI
SGAGYGVLMRKYGVSADHVIDARIVNVDGEILDRESMGEDLFWAIRGGGGASFGVILAWK
IRLVPVPPTVTIFIVPKTLEEGATALLHKWQFIGDNVHEDLFIGLSMRSVIISPKGDKTI
LVSFIGLFLGGSDKLVQHMEQSFPELGVKPHDCIEMSWIKSTVVFGVFSNDASLSVLLDR
KNPFPPKSYHKVKSDYVTEPLPISVLEGICHRFLKNGVNKAEIIMSPYGGRMNEISESEI
AFPHRKGNLYKINYIAEWEEAGSMENHLSWIRELYRYMTPYVSKSPRSSYLNFKDIDLGQ
TKNGTATYSQAKAWGSKYFKNNFKRLMQVKTKVDPNNFFCNEQGIPPFSS
Reference
  Authors
Gesell A, Chavez ML, Kramell R, Piotrowski M, Macheroux P, Kutchan TM
  Title
Heterologous expression of two FAD-dependent oxidases with (S)-tetrahydroprotoberberine oxidase activity from Arge mone mexicana and Berberis wilsoniae in insect cells.
  Journal
Planta 233:1185-97 (2011)
DOI:10.1007/s00425-011-1357-4

DBGET integrated database retrieval system