KEGG   Addendum: AEG78648
Entry
AEG78648          CDS       T10000                                 

Gene name
arsA
Definition
(KEGG) nicotinate D-ribonucleotide:phenol phospho-D-ribosyltransferase (EC:2.4.2.55)
  KO
K21299  nicotinate D-ribonucleotide:phenol phospho-D-ribosyltransferase [EC:2.4.2.55]
Taxonomy
TAX:2378
  Lineage
Bacteria; Firmicutes; Negativicutes; Selenomonadales; Sporomusaceae; Sporomusa
Organism
ag  Addendum (Sporomusa ovata)
Motif
Pfam: DBI_PRT
Other DBs
NCBI-ProteinID: AEG78648
GB: JF895493
UniProt: F6MZ55
Structure
PDB: 
4HDR 4HDK 4HDM 4HDN 4HDS

AA seq 350 aa
MEVIMSLLQATVAKIMRPDTVIKDQVKTKLAGVLQSAGSLGRLEDMVEQYAGITGELNPA
LPKPCMVVASADHGVARRVVSAYPIETTIHMTANYLISQGASANAFANFCGADMVVVDMG
VAGDLSYVPGLWHRKIAYGTQDFTEGPAMTREQAIQAVETGIDIVNDRVKHGNRCFCLGE
MGIGNTTSSATIVGAFTGLAPEKVTGRGTGISDSRLKTKMEIVGRALAVNKPNPQDGLDV
LAKVGGFELGALAGVILGSAANRCAVVIDGLNTTAAALIANVIHPLSKEYMFASHLSGEP
AHSIALRQLQLEACLELGVRLGEGIGASMVVDMLYVAIKLLNNRGGKANA
Reference
  Authors
Chan CH, Escalante-Semerena JC
  Title
ArsAB, a novel enzyme from Sporomusa ovata activates phenolic bases for adenosylcobamide biosynthesis.
  Journal
Mol Microbiol 81:952-67 (2011)
DOI:10.1111/j.1365-2958.2011.07741.x

DBGET integrated database retrieval system