KEGG   Addendum: AFN26666
Entry
AFN26666          CDS       T10000                                 
Symbol
UGT73C10
Name
(KEGG) oleanolate 3-O-glucosyltransferase (EC:2.4.1.368)
  KO
K23525  oleanolate 3-O-glucosyltransferase [EC:2.4.1.368]
Taxonomy
TAX:50459
  Lineage
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Cardamineae; Barbarea
Organism
ag  Addendum (Barbarea vulgaris)
SSDB
Motif
Pfam: UDPGT
Other DBs
NCBI-ProteinID: AFN26666
GB: JQ291613
UniProt: K4GKX2
AA seq 495 aa
MVSEITHKSYPLHFVLFPFMAQGHMIPMVDIARLLAQRGVKITIVTTPHNAARFENVLSR
AIESGLPISIVQVKLPSQEAGLPEGNETFDSLVSTKLLVPFFKAVNMLEEPVQKLFEEMS
PQPSCIISDFCLPYTSKIAKKFNIPKILFHGMCCFCLLCMHVLRKNREILENLKSDKEHF
VVPYFPDRVEFTRPQVPLATYVPGEWHEIKEDMVEADKTSYGVIVNTYQELEPAYANGYK
EARSGKAWTIGPVSLCNKVGADKAERGNKADIDQDECLKWLDSKEEGSVLYVCLGSICSL
PLSQLKELGLGLEESQRPFIWVVRGWEKNKELLEWFSESGFEERVKDRGLLIKGWSPQML
ILAHHSVGGFLTHCGWNSTLEGITSGVPLLTWPLFGDQFCNQKLVVQVLKVGVSAGVEEV
TNWGEEEKIGVLVDKEGVKKAVEELMGESDDAKEIRKRVKELGQLAHKAVEEGGSSHSNI
TSLLEDIMQLAQPNN
Reference
  Authors
Augustin JM, Drok S, Shinoda T, Sanmiya K, Nielsen JK, Khakimov B, Olsen CE, Hansen EH, Kuzina V, Ekstrom CT, Hauser T, Bak S
  Title
UDP-glycosyltransferases from the UGT73C subfamily in Barbarea vulgaris catalyze sapogenin 3-O-glucosylation in saponin-mediated insect resistance.
  Journal
Plant Physiol 160:1881-95 (2012)
DOI:10.1104/pp.112.202747

DBGET integrated database retrieval system