KEGG   Addendum: AFV09099
Entry
AFV09099          CDS       T10000                                 
Symbol
TPS2
Name
(KEGG) kunzeaol synthase (EC:4.2.3.143)
  KO
K21986  kunzeaol synthase [EC:4.2.3.143]
Taxonomy
TAX:79022
  Lineage
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiaceae; Apioideae; Scandiceae; Daucinae; Thapsia
Organism
ag  Addendum (Thapsia garganica)
SSDB
Motif
Pfam: Terpene_synth_C Terpene_synth Terpene_syn_C_2
Other DBs
NCBI-ProteinID: AFV09099
GB: JQ290345
UniProt: K4LMW2
AA seq 561 aa
MAVYVNSTTGPPSSVVRNSAGFHPSIWGDTFIPSGNSAVQKTDVDRKEEENLQLLKQEVK
KMLTAGDTCQQDLICLIDDIQRLGLSYHFEAEIDTLLQHVKDSYLEYYGTKNHDNLHDVA
LSFRLLRQEGHNISSDVFSKFQDSDGKFNEKLVKDVRGMLSLFEAAHLSVHGENILEDAL
EFTTSHLNSYLNSNPNAPLADLVRRALKYPLRKSFNRMVARHYISIYHKYYWHKQVLLDL
AKCDFNLVQKVHQKELGYITRWWKDLDFTNKLPFARDRVVECYFWITGVYFEPRYAAPRK
FLTKVISLTSIIDDIYDVYGTPEELVQLTDAIDKWDINILDQLPEYMRHAYKPLLDVFAE
GEEEMAKEGLPTYGVDYAKEAFKRLTVTYLHEAKWLQAQYFPTFEEYMSVALVSGAVKML
SVSSFVRMGNIATREAFEWLSKDPLIVNGLSVICRLSDDIVGHEFENQRPHIPSAVECYM
KSHHVTKETAYAELRKPIINAWKDMNEECLQPEAPPKPLLERVFNLARVINFLYDGHDGY
THSSTRTKDMITSVLINPIPA
Reference
  Authors
Pickel B, Drew DP, Manczak T, Weitzel C, Simonsen HT, Ro DK
  Title
Identification and characterization of a kunzeaol synthase from Thapsia garganica: implications for the biosynthesis of the pharmaceutical thapsigargin.
  Journal
Biochem J 448:261-71 (2012)
DOI:10.1042/BJ20120654

DBGET integrated database retrieval system