KEGG   Addendum: AGC65457
Entry
AGC65457          CDS       T10000                                 

Symbol
tcpX
Name
(KEGG) flavin redectase
  KO
K15245  flavin reductase [EC:1.5.1.37]
Taxonomy
TAX:657395
  Lineage
Bacteria; Proteobacteria; Betaproteobacteria; Burkholderiales; Burkholderiaceae; Ralstonia
Organism
ag  Addendum (Ralstonia sp. T6)
SSDB
Motif
Pfam: Flavin_Reduct
Other DBs
NCBI-ProteinID: AGC65457
GB: KC294622
UniProt: L7VG07
AA seq 183 aa
MSSAVSIEAVASRITDPGIDAASFRDALSHAVTAVTVIATDGAGGRAGVTCSAVCSVSDS
PPTVLFCINRRSAANSVIKTNGVVSINWLHASQTSVSQLFAGAGAVPMAQRFDGGSWGVF
TTGAPYSKSAMVALDCKVVDRIEIGTHSVFVAQVFGSAGGERGNDTPLVYWRRNYATTHP
VAD
Reference
  Authors
Li J, Huang Y, Hou Y, Li X, Cao H, Cui Z
  Title
Novel gene clusters and metabolic pathway involved in 3,5,6-trichloro-2-pyridinol degradation by Ralstonia sp. strain T6.
  Journal
Appl Environ Microbiol 79:7445-53 (2013)
DOI:10.1128/AEM.01817-13

DBGET integrated database retrieval system