KEGG   Addendum: AGH68979
Entry
AGH68979          CDS       T10000                                 

Symbol
nox
Name
(KEGG) nicotine amine oxidase
  KO
K20169  nicotine oxidoreductase [EC:1.5.3.-]
Taxonomy
TAX:879273
  Lineage
Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; Pseudomonadaceae; Pseudomonas
Organism
ag  Addendum (Pseudomonas sp. HZN6)
SSDB
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO FAD_oxidored Pyr_redox_2 FAD_binding_2 HI0933_like Thi4 GIDA FAD_binding_3 Lycopene_cycl TAT_signal Pyr_redox
Other DBs
NCBI-ProteinID: AGH68979
GB: JN391188
UniProt: M4T5L3
AA seq 478 aa
MDEKRNNGLSRRSFIGGAAVVTAGAAGLGLIGSANATENGTSKRATGFDYDVIVVGGGFA
GATAARECGHQGYKTLLLEARSRLGGRTFTSHFAGQEIEFGGAWVHWLQPHVWSEMQRYG
LGVVEDPLTNLDKTLVMYNDGSVEDLPPEVFGTNIQVAFEKMCHDAWEAFPRPHEPMFTE
RARKLDKMSVLDRINQLELTRAQRAELNSYMALYGGETTDKYGLPGVLKLFACGGWNYNA
FMDTETHYRIEGGTIGLINAMLADSGAEVRLNMPVISVEQLNGGVRVETDDGETITAGTI
IMTVPLNTYRHINFTPALSEGKQRFIQEGQLSKGAKLYVHVKENLGRVFAFADEQQPLNW
VQTHDYGDELGTILSITIARAETIDVNDRDAVTREIRKLFPGVEVLGIAAYDWTADPFSL
GAWAAYGVGQLSRLTDLQQPEGRILFAGAETSNGWHANIDGAVESGLRAGREAKEILG
Reference
  Authors
Qiu J, Ma Y, Wen Y, Chen L, Wu L, Liu W
  Title
Functional identification of two novel genes from Pseudomonas sp. strain HZN6 involved in the catabolism of nicotine.
  Journal
Appl Environ Microbiol 78:2154-60 (2012)
DOI:10.1128/AEM.07025-11
Reference
  Authors
Qiu J, Ma Y, Zhang J, Wen Y, Liu W
  Title
Cloning of a novel nicotine oxidase gene from Pseudomonas sp. strain HZN6 whose product nonenantioselectively degrades nicotine to pseudooxynicotine.
  Journal
Appl Environ Microbiol 79:2164-71 (2013)
DOI:10.1128/AEM.03824-12

DBGET integrated database retrieval system