KEGG   Addendum: AGL44334
Entry
AGL44334          CDS       T10000                                 

Symbol
DBOX
Name
(KEGG) dihydrobenzophenanthridine oxidase
  KO
K22089  tetrahydroprotoberberine oxidase [EC:1.3.3.8]
Taxonomy
TAX:3469
  Lineage
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; Ranunculales; Papaveraceae; Papaveroideae; Papaver
Organism
ag  Addendum (Papaver somniferum)
SSDB
Motif
Pfam: FAD_binding_4 BBE DUF5390
Other DBs
NCBI-ProteinID: AGL44334
GB: JX390714
UniProt: R4NDV8
AA seq 537 aa
MMMSSSNILPLVTFLVLVFFSSGSWAANNSLNGDFLQCIKKNEYSSIPIPIFTPDNSSFT
TIFRSSARNLRFLTPNSTQTPQFIITPTHESHVQSAVVCSQKHGFDLKVRSGGHDVEGLS
YVSDTPYVLVDLINFRNIIVDLKEKTAWIQAGASLGEVYYQAANKSNNTLGFPAGFCPTV
GVAGHISGGGFGALVRKYGLASDQVIDARIVTVDGKIYTKETMGKDLYWAIRGGGANNFG
VLLSWKVKLVPVTPVVTVATISRTLEQGATDLVHKWQFVADRLHEDVYIGLTFSVANSSR
AGGKTVSVQFAFLFLGGSDRLLELMEESFPELGLKRNETTEMKWVESHVYFYARGRPIEL
LWDRDHATKSFLKIKADYVREPISKSGLEAIWRRFVGGDSPAMLWTPFGGRMNEISEFET
PYPHRAGNIYNIMYVGNWMNETESEKQIDWMRRFYNSMARYVSKNPRSAYINYKDLDLGV
NRNNVSEAVGYVQARSWGRKYFKSNFERLVKVKSMVDPGNFFKNKQSIPPVSTWGKQ
Reference
  Authors
Hagel JM, Beaudoin GA, Fossati E, Ekins A, Martin VJ, Facchini PJ
  Title
Characterization of a flavoprotein oxidase from opium poppy catalyzing the final steps in sanguinarine and papaverine biosynthesis.
  Journal
J Biol Chem 287:42972-83 (2012)
DOI:10.1074/jbc.M112.420414

DBGET integrated database retrieval system