KEGG   Addendum: AGN04215
Entry
AGN04215          CDS       T10000                                 

Gene name
CYP76AH1
Definition
(KEGG) ferruginol synthase (EC:1.14.14.175)
  KO
K20513  ferruginol synthase [EC:1.14.14.175]
Taxonomy
TAX:226208
  Lineage
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salviinae; Salvia; Salvia incertae sedis
Organism
ag  Addendum (Salvia miltiorrhiza)
Motif
Pfam: p450
Other DBs
NCBI-ProteinID: AGN04215
GB: JX422213
UniProt: S4UX02
Structure
PDB: 
5YLW 5YM3

AA seq 495 aa
MDSFPLLAALFFIAATITFLSFRRRRNLPPGPFPYPIVGNMLQLGANPHQVFAKLSKRYG
PLMSIHLGSLYTVIVSSPEMAKEILHRHGQVFSGRTIAQAVHACDHDKISMGFLPVASEW
RDMRKICKEQMFSNQSMEASQGLRRQKLQQLLDHVQKCSDSGRAVDIREAAFITTLNLMS
ATLFSSQATEFDSKATMEFKEIIEGVATIVGVPNFADYFPILRPFDPQGVKRRADVFFGK
LLAKIEGYLNERLESKRANPNAPKKDDFLEIVVDIIQANEFKLKTHHFTHLMLDLFVGGS
DTNTTSIEWAMSELVMNPDKMARLKAELKSVAGDEKIVDESAMPKLPYLQAVIKEVMRIH
PPGPLLLPRKAESDQEVNGYLIPKGTQILINAYAIGRDPSIWTDPETFDPERFLDNKIDF
KGQDYELLPFGSGRRVCPGMPLATRILHMATATLVHNFDWKLEDDSTAAADHAGELFGVA
VRRAVPLRIIPIVKS
Reference
  Authors
Guo J, Zhou YJ, Hillwig ML, Shen Y, Yang L, Wang Y, Zhang X, Liu W, Peters RJ, Chen X, Zhao ZK, Huang L
  Title
CYP76AH1 catalyzes turnover of miltiradiene in tanshinones biosynthesis and enables heterologous production of ferruginol in yeasts.
  Journal
Proc Natl Acad Sci U S A 110:12108-13 (2013)
DOI:10.1073/pnas.1218061110

DBGET integrated database retrieval system