KEGG   Addendum: AGR44631
Entry
AGR44631          CDS       T10000                                 
Symbol
UGT74AE2
Name
(KEGG) protopanaxadiol-type ginsenoside 3-O-glucosyltransferase (EC:2.4.1.364)
  KO
K23521  protopanaxadiol-type ginsenoside 3-O-glucosyltransferase [EC:2.4.1.364]
Taxonomy
TAX:4054
  Lineage
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Araliaceae; Panax
Organism
ag  Addendum (Panax ginseng)
SSDB
Motif
Pfam: UDPGT Glyco_tran_28_C Glyco_trans_1_3 Glyco_transf_28
Other DBs
NCBI-ProteinID: AGR44631
GB: JX898529
UniProt: A0A0A6ZFR4
AA seq 451 aa
MLSKTHIMFIPFPAQGHMSPMMQFAKRLAWKGVRITIVLPAQIRDSMQITNSLINTECIS
FDFDKDDGMPYSMQAYMGVVKLKVTNKLSDLLEKQKTNGYPVNLLVVDSLYPSRVEMCHQ
LGVKGAPFFTHSCAVGAIYYNAHLGKLKIPPEEGLTSVSLPSIPLLGRDDLPIIRTGTFP
DLFEHLGNQFSDLDKADWIFFNTFDKLENEEAKWLSSQWPITSIGPLIPSMYLDKQLPND
KGNGINLYKADVGSCIKWLDAKDPGSVVYASFGSVKHNFGDDYMDEVAWGLLHSKYNFIW
VVIEPERTKLSSDFLAEAEEKGLIVSWCPQLEVLSHKSIGSFMTHCGWNSTVEALSLGVP
MVAVPQQFDQPVNAKYIVDVWQIGVRVPIGEDGVVLRGEVANCIKDVMEGEIGDELRGNA
LKWKGLAVEAMEKGGSSDKNIDEFISKLVSS
Reference
  Authors
Jung SC, Kim W, Park SC, Jeong J, Park MK, Lim S, Lee Y, Im WT, Lee JH, Choi G, Kim SC
  Title
Two ginseng UDP-glycosyltransferases synthesize ginsenoside Rg3 and Rd.
  Journal
Plant Cell Physiol 55:2177-88 (2014)
DOI:10.1093/pcp/pcu147

DBGET integrated database retrieval system