KEGG   Addendum: AIO10965
Entry
AIO10965          CDS       T10000                                 
Symbol
TPS02
Name
(KEGG) alpha-selinene synthase (EC:4.2.3.198)
  KO
K23172  alpha-selinene synthase [EC:4.2.3.198]
Taxonomy
TAX:63359
  Lineage
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Altingiaceae; Liquidambar
Organism
ag  Addendum (Liquidambar formosana)
SSDB
Motif
Pfam: Terpene_synth_C Terpene_syn_C_2 Terpene_synth PRTRC_E CDC4_D AAA_14
Other DBs
NCBI-ProteinID: AIO10965
GB: KF874662
UniProt: A0A1L1WGF5
AA seq 555 aa
MSVPVSATISQNAKPKVIRKTANFQPSIWGDQFVTYTSDDAITHAHKEKQVEELKEEVRR
ELMTRVDQPSKQLKFIDAIQRLGVAYHFDREIEEALQHIYDDRLDNGDEDLYNVSLWFRL
LRQEGYNVSSDILYKFKNDEGNFKESLIGDVQGMLGLYEATHLRIHGEDVLDEALAFTTI
HLESMATSRASDPLMAQVIHALKQPIRKGLPRLEAGRFISIYQEDGSHNEALLKLAKLDF
NLLQSLHRKELSEIARWWKDLDFARKLPYVRDRVVECFFWILGVYFEPQYSLARRILTKV
ISMTSVIDDIYDAYGTFEELELFTEAIERWDINFLDQLPEYMKFVYQALLDVYAEIEEEM
SKQARAYRVHYAKEAMKNLVQVYFVEAKWFNEGYIPPMEEYMPVALLSCGYPMLITASFV
GMGEVVTKEAFDWVFNNPKIVKASSIINRLMDDIVSHQFEQERGHVASGVECYMKQYGAS
KQEVFDEFNKQVVNAWKDINEEFLRPTDVPFPLLLRALNFARVMDVLYKDKDGYTHVGKT
TKDRIASLLIDPVAI
Comment
Unpublished sequence data: Chu FH, Wen CH, Lee YR, Chuang L (2013).
Reference
  Authors
Chuang L, Wen CH, Lee YR, Lin YL, Hsu LR, Wang SY, Chu FH
  Title
Identification, Functional Characterization, and Seasonal Expression Patterns of Five Sesquiterpene Synthases in Liquidambar formosana.
  Journal
J Nat Prod 81:1162-1172 (2018)
DOI:10.1021/acs.jnatprod.7b00773

DBGET integrated database retrieval system