KEGG   Addendum: AJD80254
Entry
AJD80254          CDS       T10000                                 

Symbol
PT1L
Name
(KEGG) 2-acylphloroglucinol 4-prenyltransferase (EC:2.5.1.136)
  KO
K21590  2-acylphloroglucinol 4-prenyltransferase [EC:2.5.1.136]
Taxonomy
TAX:3486
  Lineage
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Humulus
Organism
ag  Addendum (Humulus lupulus)
SSDB
Motif
Pfam: UbiA
Other DBs
NCBI-ProteinID: AJD80254
GB: KM222441
UniProt: A0A0B5A051
AA seq 414 aa
MELSSVSSFSLGTNPFISIPHNNNNNLKVSSYCCKSKSRVINSTNSKHCSPNNNNNNNTS
NKTTHLLGLYGQSRCLLKPLSIFSCKDQRGNSIRASAQIEDRPPESGNLSALTNVKDFVS
VCWEYVRPYTAKGVIICSSCLFGRELLENPNLFSWPLIFRALLGMLAILGSCFYTAGINQ
IFDMDIDRINKPDLPLVSGRISVESAWLLTLSPAIIGFILILKLNSGPLLTSLYCLAILS
GTIYSVPPFRWKKNPITAFLCILMIHAGLNFSVYYASRAALGLAFVWSPSFSFITAFITF
MTLTLASSKDLSDINGDRKFGVETFATKLGAKNITLLGTGLLLLNYVAAISTAIIWPKAF
KSNIMLLSHAILAFSLFFQARELDRTNYTPEACKSFYEFIWILFSAEYVVYLFI
Reference
  Authors
Li H, Ban Z, Qin H, Ma L, King AJ, Wang G
  Title
A heteromeric membrane-bound prenyltransferase complex from hop catalyzes three sequential aromatic prenylations in the bitter acid pathway.
  Journal
Plant Physiol 167:650-9 (2015)
DOI:10.1104/pp.114.253682

DBGET integrated database retrieval system