KEGG   Addendum: AJQ30186
Entry
AJQ30186          CDS       T10000                                 

Symbol
FS
Name
(KEGG) ferruginol synthase (EC:1.14.14.175)
  KO
K20513  ferruginol synthase [EC:1.14.14.175]
Taxonomy
TAX:268906
  Lineage
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salviinae; Salvia; Salvia incertae sedis
Organism
ag  Addendum (Salvia fruticosa)
SSDB
Motif
Pfam: p450
Other DBs
NCBI-ProteinID: AJQ30186
GB: KP091842
UniProt: A0A0C5QRZ2
AA seq 492 aa
MDPFPLVAAALFIAATWFITFKRRRNLPPGPFPYPIVGNMLQLGSQPHETFAKLSKKYGP
LMSIHLGSLYTVIISSPEMAKEIMHKYGQVFSGRTIAQAVHACDHDKISMGFLPVGAEWR
DMRKICKEQMFSHQSMEDSQNLRKQKLQQLLEYAQKCSEEGRGIDIREAAFITTLNLMSA
TLFSMQATEFDSKVTMEFKEIIEGVASIVGVPNFADYFPILRPFDPQGVKRRADVYFGRL
LGLIEGYLNERIEFRKANPNAPKKDDFLETLVDALDAKDYKLKTEHLTHLMLDLFVGGSE
TSTTEIEWIMWELLASPEKMAKVKAELKSVMGGEKVVDESMMPRLPYLQAVVKESMRLHP
PGPLLLPRKAESDQVVNGYLIPKGAQVLINAWAMGRDPSLWKNPDSFEPERFLDQKIDFK
GTDYELIPFGSGRRVCPGMPLANRILHTVTATLVHNFDWKLERPEASDAHKGVLFGFAVR
RAVPLKIVPIKA
Reference
  Authors
Bozic D, Papaefthimiou D, Bruckner K, de Vos RC, Tsoleridis CA, Katsarou D, Papanikolaou A, Pateraki I, Chatzopoulou FM, Dimitriadou E, Kostas S, Manzano D, Scheler U, Ferrer A, Tissier A, Makris AM, Kampranis SC, Kanellis AK
  Title
Towards Elucidating Carnosic Acid Biosynthesis in Lamiaceae: Functional Characterization of the Three First Steps of the Pathway in Salvia fruticosa and  Rosmarinus officinalis.
  Journal
PLoS One 10:e0124106 (2015)
DOI:10.1371/journal.pone.0124106

DBGET integrated database retrieval system