KEGG   Addendum: AJQ30187
Entry
AJQ30187          CDS       T10000                                 

Symbol
FS1
Name
(KEGG) ferruginol synthase (EC:1.14.14.175)
  KO
K20513  ferruginol synthase [EC:1.14.14.175]
Taxonomy
TAX:39367
  Lineage
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salviinae; Salvia; Salvia subgen. Rosmarinus
Organism
ag  Addendum (Salvia rosmarinus)
SSDB
Motif
Pfam: p450 UT
Other DBs
NCBI-ProteinID: AJQ30187
GB: KP091843
UniProt: A0A0C5Q4Y6
AA seq 493 aa
MDSFPLLAALFFILAATWFISFRRPRNLPPGPFPYPIVGNMLQLGTQPHETFAKLSKKYG
PLMSIHLGSLYTVIVSSPEMAKEIMHKYGQVFSGRTVAQAVHACGHDKISMGFLPVGGEW
RDMRKICKEQMFSHQSMEDSQWLRKQKLQQLLEYAQKCSERGRAIDIREAAFITTLNLMS
ATLFSMQATEFDSKVTMEFKEIIEGVASIVGVPNFADYFPILRPFDPQGVKRRADVYFGR
LLAIIEGFLNERVESRRTNPNAPKKDDFLETLVDTLQTNDNKLKTDHLTHLMLDLFVGGS
ETSTTEIEWIMWELLANPEKMAKMKAELKSVMGEEKVVDESQMPRLPYLQAVVKESMRLH
PPGPLLLPRKAESDQVVNGYLIPKGAQVLINAWAIGRDHSIWKNPDSFEPERFLDQKIDF
KGTDYELIPFGSGRRVCPGMPLANRILHTVTATLVHNFDWKLERPEASDAHRGVLFGFAV
RRAVPLKIVPFKV
Reference
  Authors
Bozic D, Papaefthimiou D, Bruckner K, de Vos RC, Tsoleridis CA, Katsarou D, Papanikolaou A, Pateraki I, Chatzopoulou FM, Dimitriadou E, Kostas S, Manzano D, Scheler U, Ferrer A, Tissier A, Makris AM, Kampranis SC, Kanellis AK
  Title
Towards Elucidating Carnosic Acid Biosynthesis in Lamiaceae: Functional Characterization of the Three First Steps of the Pathway in Salvia fruticosa and  Rosmarinus officinalis.
  Journal
PLoS One 10:e0124106 (2015)
DOI:10.1371/journal.pone.0124106

DBGET integrated database retrieval system