KEGG   Addendum: AJT38682
Entry
AJT38682          CDS       T10000                                 

Symbol
ind1
Name
(KEGG) indolepyruvate C-methyltransferase (EC:2.1.1.47)
  KO
K22590  indolepyruvate C-methyltransferase [EC:2.1.1.47]
Taxonomy
TAX:1911
  Lineage
Bacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces
Organism
ag  Addendum (Streptomyces griseus)
SSDB
Motif
Pfam: Methyltransf_25 Methyltransf_23 Methyltransf_11 Methyltransf_31 Methyltransf_12 Methyltransf_2 MTS PCMT CMAS Ubie_methyltran MetW Methyltransf_18 UPF0020 PrmA
Other DBs
NCBI-ProteinID: AJT38682
GB: KM596502
UniProt: A0A0D4BS77
AA seq 329 aa
MTRTDFAQSAVASIFTGAIASHAAVLADDLGLFDALAKGKLRNRDLDRSPWLRNRIRISG
ALEALCRVGAVQRCTDGYELTDVGTELAGQVPVFRLWLGGYASVLAGQISIGADPATGVH
GGIVAESSGAIGARYLDETIVNLLESLRPEGRICDIGCGTGARLLRVCRRVNQPGIGYDL
SAKAVEAARETVDEARRIGVDIDVRQGDATALTQDHPDVDIVTQAFMTHHIAPDEYCAAV
LRSYRSRFPRARYLVIFDTVPSQDSEEPEIFAPGFDYIHALQNMEPRSRGAARRMFTEAG
YICREEVELAVPNSYAWVLEMRDREGPAS
Reference
  Authors
Du YL, Alkhalaf LM, Ryan KS
  Title
In vitro reconstitution of indolmycin biosynthesis reveals the molecular basis of oxazolinone assembly.
  Journal
Proc Natl Acad Sci U S A 112:2717-22 (2015)
DOI:10.1073/pnas.1419964112

DBGET integrated database retrieval system