KEGG   Addendum: AKQ76388
Entry
AKQ76388          CDS       T10000                                 
Symbol
UGTPg100
Name
(KEGG) ginsenoside 6-O-glucosyltransferase (EC:2.4.1.367)
  KO
K23524  ginsenoside 6-O-glucosyltransferase [EC:2.4.1.367]
Taxonomy
TAX:4054
  Lineage
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Araliaceae; Panax
Organism
ag  Addendum (Panax ginseng)
SSDB
Motif
Pfam: UDPGT Glyco_tran_28_C DUF2112
Other DBs
NCBI-ProteinID: AKQ76388
GB: KP795113
UniProt: A0A0K0PVW1
AA seq 472 aa
MKSELIFLPVPAFGHLVGMVEMAKLFISRHENLSVTVLISKFFIDTGIDNYNKSLLAKPT
PRLTIINLPEIDPQKYLLKPRCAIFPSLIENQKTHVRDVMSRMTQSESTRVVGLLADILF
VDIFDIADEFNVPTYVYSPAGAGFLGLAFHLQTLNDDKKQDVTEFRNSDTELLVPSFANP
VPAEFLPSIFLEKDGRHDVLLSLYWRCREAKGIIVNTFEELEPYAINSLRMDSMIPPIYP
VGPILNLNGEGQNSDEAAVILGWLDDQPPSSVVFLCFGSFGSFPENQVKEIAMGLERSGH
RFLWSLRPCISEGETTLQLKYSNLELPAGFLDRTSCVGKVIGWAPQMAILAHEAVGGFVS
HCGWNSVLESVWYGMPVATWPMYGEQQLNAFEMVKELGLAVEIEVDYRNEYNKSDFIVKA
DEIETKIKKLMMDGKNSKIRKKVKEMKEKSRVAMSENGSSYTSLAKLFEEIM
Reference
  Authors
Wei W, Wang P, Wei Y, Liu Q, Yang C, Zhao G, Yue J, Yan X, Zhou Z
  Title
Characterization of Panax ginseng UDP-Glycosyltransferases Catalyzing Protopanaxatriol and Biosyntheses of Bioactive Ginsenosides F1 and Rh1 in Metabolically Engineered Yeasts.
  Journal
Mol Plant 8:1412-24 (2015)
DOI:10.1016/j.molp.2015.05.010

DBGET integrated database retrieval system