KEGG   Addendum: ALG05144
Entry
ALG05144          CDS       T10000                                 

Gene name
CYP82D61
Definition
(KEGG) (-)-4'-demethyl-deoxypodophyllotoxin 4-hydroxylase (EC:1.14.14.132)
  KO
K21206  (-)-4'-demethyl-deoxypodophyllotoxin 4-hydroxylase [EC:1.14.14.132]
Taxonomy
TAX:93608
  Lineage
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; Ranunculales; Berberidaceae; Podophylloideae; Sinopodophyllum
Organism
ag  Addendum (Sinopodophyllum hexandrum)
Motif
Pfam: p450
Other DBs
NCBI-ProteinID: ALG05144
GB: KT390182
UniProt: A0A0N7F297
AA seq 519 aa
MDSLHCLETLLLGFFVLLPCFFYFVWKKPNNKIKEPPQPAGAWPIIGHLHLLARGDLPHK
ILSSFADKNGPVFKIQLGVHQALVVNNSEIAKECFTTNDRFFLNRPSGVAAKIMGYNYVM
LGVAPYGPYWRDMRKIIMLEFLSNRRLQSLKHVWHSEISISSKELYKLWETQNIDFCLVD
MKQWLADLTLNMSVKMVVGKRFFGSASASACEETESSNCPKTLRNMFRLMGSFVLSDYLP
YLRWLDLGGHEKEMKRTVKELDILFKGWLDEHKRKRLSGGKEDDDQDFMDVMLSILEESK
LGNDVDTINKTACLAIILGGADTTWATLTWALSLLLNNPNALKKAQDELDLHVGRDRNVD
ESDLVKLTYIDAIIKETLRLYPPGPLLGPRVVTEDCTIAGYHVRAGTRLIVNAWKIQRDP
LVWSQPHEYQPERFLERDVDMKGQHFELIPFGSGRRACPAISLALQVLPLTLAHILHGFE
LRTPNQNKVDMTETPGIVHAKATPLEVLVAPRISPKCFV
Reference
  Authors
Lau W, Sattely ES
  Title
Six enzymes from mayapple that complete the biosynthetic pathway to the etoposide aglycone.
  Journal
Science 349:1224-8 (2015)
DOI:10.1126/science.aac7202

DBGET integrated database retrieval system